bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3099_orf1 Length=68 Score E Sequences producing significant alignments: (Bits) Value CE28286 61.6 4e-10 SPCC830.11c 51.6 4e-07 Hs7706212 50.1 1e-06 7303434 47.0 8e-06 YDL166c 43.5 9e-05 YGR125w 28.5 2.9 At5g28740 27.3 6.7 CE28224 26.9 9.4 > CE28286 Length=182 Score = 61.6 bits (148), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 28/60 (46%), Positives = 42/60 (70%), Gaps = 0/60 (0%) Query 1 LFDRLTARQYPQKKIDENMQAEIFQVLLDEARETFGEDKIKELQNNTIQQLNDNVTAAAE 60 L+DRL +R Y + KI EN++ EIF LL+EARE++ ED + ELQ+ T +Q+ +N+ E Sbjct 110 LYDRLQSRGYSEFKIKENVECEIFGTLLEEARESYSEDIVHELQSETTEQMEENLERICE 169 > SPCC830.11c Length=175 Score = 51.6 bits (122), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/64 (37%), Positives = 41/64 (64%), Gaps = 0/64 (0%) Query 1 LFDRLTARQYPQKKIDENMQAEIFQVLLDEARETFGEDKIKELQNNTIQQLNDNVTAAAE 60 L++RL +R Y +KI EN +AEI Q+ L+EARE+F + EL + +I+++ N++ + Sbjct 107 LWERLESRGYSLEKIQENNEAEIMQICLEEARESFDPKIVVELPSESIEEMESNLSRITQ 166 Query 61 AYNN 64 N Sbjct 167 WVTN 170 > Hs7706212 Length=172 Score = 50.1 bits (118), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 39/55 (70%), Gaps = 0/55 (0%) Query 1 LFDRLTARQYPQKKIDENMQAEIFQVLLDEARETFGEDKIKELQNNTIQQLNDNV 55 L++RL R Y +KK+ +N+Q EIFQVL +EA ++ E+ + +L +N ++L +NV Sbjct 102 LYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNV 156 > 7303434 Length=175 Score = 47.0 bits (110), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 32/47 (68%), Gaps = 0/47 (0%) Query 1 LFDRLTARQYPQKKIDENMQAEIFQVLLDEARETFGEDKIKELQNNT 47 L+DRL R Y +KK+ N+Q EIF +L+EAR+++ D + EL+ T Sbjct 108 LYDRLKERNYNEKKLASNIQCEIFGTILEEARDSYKSDIVFELKGET 154 > YDL166c Length=197 Score = 43.5 bits (101), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 0/56 (0%) Query 1 LFDRLTARQYPQKKIDENMQAEIFQVLLDEARETFGEDKIKELQNNTIQQLNDNVT 56 L+ RL AR Y KI+EN+ AEI V+ +A E++ + ELQ++T + + NV+ Sbjct 107 LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVS 162 > YGR125w Length=1036 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 0/42 (0%) Query 12 QKKIDENMQAEIFQVLLDEARETFGEDKIKELQNNTIQQLND 53 ++ IDE E ++LL A +D+ + LQN+++ +L D Sbjct 132 EENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELED 173 > At5g28740 Length=917 Score = 27.3 bits (59), Expect = 6.7, Method: Compositional matrix adjust. Identities = 10/37 (27%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 13 KKIDENMQAEIFQVLLDEARETFGEDKIKELQNNTIQ 49 KK+ E + E++++ + A E FG + +E+ I+ Sbjct 652 KKVPEGQKLEMYEIYISRAAEIFGVPRTREIYEQAIE 688 > CE28224 Length=1088 Score = 26.9 bits (58), Expect = 9.4, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 16 DENMQAEIFQVLLDEARETFGEDKIKELQNNTIQQ 50 + +E+ Q+ ++ ETF ED + EL NN Q+ Sbjct 248 ESQTMSEVDQLPSEQVAETFSEDNVNELDNNANQK 282 Lambda K H 0.315 0.130 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1203543208 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40