bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3234_orf1 Length=86 Score E Sequences producing significant alignments: (Bits) Value At2g05170 53.5 8e-08 Hs17978477 42.4 2e-04 Hs22043215 29.6 1.3 Hs6912418 29.6 1.5 At5g16210 29.6 1.5 CE01618 28.9 2.3 CE06950 28.1 3.7 At5g64960 27.3 6.5 CE06447 26.9 9.3 > At2g05170 Length=932 Score = 53.5 bits (127), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 47/73 (64%), Gaps = 0/73 (0%) Query 9 RQIREVLMHIERHRLLPPLTVLEVLQQSPAVTLDAVKDYFLRASDELSEHLEQSQALLQS 68 ++++EVL +IER +LPP+ VL+ L ++P +TL +KDY R ++ S+ +E+ + ++ Sbjct 756 KEVKEVLTYIERDDILPPIIVLQTLAKNPCLTLSVIKDYIARKLEQESKIIEEDRRAVEK 815 Query 69 DRAEVSYMAKEID 81 + M KEI+ Sbjct 816 YQETTKNMRKEIE 828 > Hs17978477 Length=941 Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 0/74 (0%) Query 11 IREVLMHIERHRLLPPLTVLEVLQQSPAVTLDAVKDYFLRASDELSEHLEQSQALLQSDR 70 + VL HIE L+PPL V++ L + TL ++DY ++ + S+ + Q + ++ R Sbjct 738 VAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVRRYR 797 Query 71 AEVSYMAKEIDRYK 84 E + + +EI K Sbjct 798 EETTRIRQEIQELK 811 > Hs22043215 Length=268 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 7/58 (12%) Query 22 RLLPPLTVLEVLQQSPAVTLDAVKDYFLRASDELSEHLEQSQALLQSDRAEVSYMAKE 79 RL P L +L PA+T + V D+ LRAS LS + +AL S RA +++A E Sbjct 87 RLPPSLRLL------PAMTEEVVGDHHLRASKGLSNLNRRVRALAPS-RAGKAFVATE 137 > Hs6912418 Length=578 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 0/53 (0%) Query 12 REVLMHIERHRLLPPLTVLEVLQQSPAVTLDAVKDYFLRASDELSEHLEQSQA 64 +E+L + ++PP+ +L +T K YF++ +EL + LEQS A Sbjct 495 KEMLKFQDATAVVPPMCLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLEQSLA 547 > At5g16210 Length=1189 Score = 29.6 bits (65), Expect = 1.5, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Query 30 LEVLQQSPAVTLDAVKDYFLRASDELSEHLEQSQALLQSD---RAEVSYMAKEID 81 L+V Q SPA DA++ Y+ + SE E+ A+LQ + + E+ ++KE D Sbjct 183 LDVWQDSPAHVPDALRYYYYQYLSSTSEAAEEKIAMLQENESLKKEIERLSKEKD 237 > CE01618 Length=950 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Query 18 IERHRLLPPLTVLEVLQQSPAVTLDAVKDYFLRASDELSEHLEQSQALLQSDRAEV 73 IE + PL VLE+L ++ +T+ +V+DY + L + Q +++ DR + Sbjct 696 IEASEQIHPLVVLELLAKNEHLTISSVRDYII-------AWLRKQQIIIEEDRNTI 744 > CE06950 Length=1613 Score = 28.1 bits (61), Expect = 3.7, Method: Compositional matrix adjust. Identities = 10/32 (31%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 6 GMERQIREVLMHIERHRLLPPLTVLEVLQQSP 37 G + I+ +L+H+E +LP +L+ +Q++P Sbjct 399 GTKNTIQHILVHMENEDILPLGQILKTIQETP 430 > At5g64960 Length=513 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 5/51 (9%) Query 1 LASQKGMERQIREVLMHIERH--RLLPPLTVLEVLQQSPAV-TLDAVKDYF 48 + S + ++R++RE+ H +RH LL + VL+ Q+ A LDA +YF Sbjct 277 MKSSRPLKRRVREIYRHFDRHALELLEKMLVLDPSQRICAKDALDA--EYF 325 > CE06447 Length=652 Score = 26.9 bits (58), Expect = 9.3, Method: Compositional matrix adjust. Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 10/64 (15%) Query 2 ASQKGMERQIREVLMHIERHRLLPPLTVLEVLQQSPAVTLDAVKDYFLRASDELSEHLEQ 61 A + G+++ +++VL H+E LLP +Q P V AV++ F+ ++E L++ Sbjct 208 AGKDGVQQCVQKVLDHLESKGLLP--------EQIPDVP--AVRELFVSDDLTVAELLKE 257 Query 62 SQAL 65 SQ L Sbjct 258 SQNL 261 Lambda K H 0.318 0.131 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1190857334 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40