bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3238_orf1 Length=61 Score E Sequences producing significant alignments: (Bits) Value At1g65280_1 56.2 1e-08 7296848 51.2 4e-07 CE05169 50.8 6e-07 YMR161w 50.4 8e-07 At5g05750 50.1 1e-06 7301050 48.5 3e-06 Hs21361912 46.6 1e-05 Hs21361589 45.8 2e-05 Hs6631085 43.9 8e-05 Hs20542283 43.9 8e-05 Hs7657611 43.5 1e-04 At5g49060 43.1 1e-04 At3g57340 42.7 1e-04 SPBC17A3.05c 42.7 1e-04 At2g01710 42.4 2e-04 7295437 42.4 2e-04 Hs22046868 42.0 3e-04 At2g25560 42.0 3e-04 HsM6912422 42.0 3e-04 7299832 41.6 4e-04 Hs21361413 41.6 4e-04 At2g35540 41.6 4e-04 Hs7706495 41.2 4e-04 At5g53150 40.8 6e-04 CE27221 40.8 6e-04 YOR254c 40.4 8e-04 Hs8923030 40.0 0.001 At2g35720 40.0 0.001 7296521 40.0 0.001 Hs18554003 39.7 0.001 At4g19570 39.7 0.001 CE24236 39.3 0.002 At3g04980 39.3 0.002 At4g19590 39.3 0.002 7296101 39.3 0.002 At2g26890 38.9 0.002 At4g19580 38.5 0.003 At5g16650 38.5 0.003 7299418 38.5 0.003 At5g18750 38.5 0.003 At3g08970 38.5 0.003 CE03412 38.5 0.003 SPBC3E7.11c 38.1 0.004 SPAC4H3.01 38.1 0.004 Hs20535925 38.1 0.004 At5g49580 38.1 0.004 SPBC1734.05c 37.7 0.005 At1g16680 37.7 0.006 7291882 37.7 0.006 At3g62600 37.4 0.006 > At1g65280_1 Length=430 Score = 56.2 bits (134), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 23/40 (57%), Positives = 34/40 (85%), Gaps = 0/40 (0%) Query 3 EDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQE 42 +++KK+Y KLSL++HPDKC H AQEAF +LNKA+++ Q+ Sbjct 329 DNMKKRYWKLSLLVHPDKCSHPQAQEAFVLLNKAFKELQD 368 > 7296848 Length=970 Score = 51.2 bits (121), Expect = 4e-07, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEE 55 S+E I+K Y+K+++++HPDK K A+EAF+VL +A+E E RL Y I E Sbjct 720 SQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQSIAE 774 > CE05169 Length=401 Score = 50.8 bits (120), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 23/49 (46%), Positives = 33/49 (67%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S++DI+K+YRKL+L +HPDKC+ A EAF+ L AY + R +Y Sbjct 149 SDDDIRKEYRKLALKLHPDKCRAPHATEAFKALGNAYAVLSDTDKRRQY 197 > YMR161w Length=224 Score = 50.4 bits (119), Expect = 8e-07, Method: Composition-based stats. Identities = 23/49 (46%), Positives = 33/49 (67%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 ++ +IKK YRKL++ +HPDK H A EAF+V+N+A+E E R Y Sbjct 33 TDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSIY 81 > At5g05750 Length=294 Score = 50.1 bits (118), Expect = 1e-06, Method: Composition-based stats. Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 0/51 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAG 51 S ED++K YRKLSL +HPDK K ++EAF+ ++KA++ E R +Y G Sbjct 126 SVEDLRKSYRKLSLKVHPDKNKAPGSEEAFKSVSKAFQCLSNEDTRRKYDG 176 > 7301050 Length=254 Score = 48.5 bits (114), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 2/59 (3%) Query 4 DIKKQYRKLSLIIHPDKC--KHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKKRV 60 DIKK+YR LS+++HPDK E AQ AF +++++++ + E R R V EEAK R Sbjct 69 DIKKRYRTLSILVHPDKNPDNQERAQMAFDIVSRSWKILENELTRKRCLEVYEEAKGRT 127 > Hs21361912 Length=554 Score = 46.6 bits (109), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVI 53 S DI+K YRKLSL +HPDK K E A+ F+ L YE +++ R RY ++ Sbjct 77 SSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDIL 129 > Hs21361589 Length=412 Score = 45.8 bits (107), Expect = 2e-05, Method: Composition-based stats. Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S+ ++KK YR+L++++HPDK H A+EAF+VL A++ R Y Sbjct 165 SDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEY 213 > Hs6631085 Length=337 Score = 43.9 bits (102), Expect = 8e-05, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 0/58 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKK 58 S+EDIKK YRK +L HPDK K A+E F+ + +AYE + R Y EE K Sbjct 16 SDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLK 73 > Hs20542283 Length=241 Score = 43.9 bits (102), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 41/54 (75%), Gaps = 6/54 (11%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHEL--AQEAFQVLNKAYE----KAQEEGVRLR 48 ++E+IKK++R+LS+++HPDK + + AQ+AF+ ++KAY+ +++ G R+R Sbjct 63 TDEEIKKRFRQLSILVHPDKNEDDADRAQKAFETVDKAYKLLLIRSKRRGKRIR 116 > Hs7657611 Length=264 Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHEL--AQEAFQVLNKAY 37 ++E+IKK++R+LS+++HPDK + + AQ+AF+ ++KAY Sbjct 80 TDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAY 118 > At5g49060 Length=350 Score = 43.1 bits (100), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY--AGVIEE 55 S ++I+K YRKLSL +HPDK K ++EAF+ ++KA+ + R ++ G+++E Sbjct 111 SVDEIRKAYRKLSLKVHPDKNKAPGSEEAFKKVSKAFTCLSDGNSRRQFDQVGIVDE 167 > At3g57340 Length=367 Score = 42.7 bits (99), Expect = 1e-04, Method: Composition-based stats. Identities = 20/49 (40%), Positives = 34/49 (69%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S +D++K YRKLSL +HPDK + ++EAF+ ++KA++ + R +Y Sbjct 125 SVDDVRKAYRKLSLKVHPDKNQAPGSEEAFKSVSKAFQCLSNDEARKKY 173 > SPBC17A3.05c Length=403 Score = 42.7 bits (99), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 33/49 (67%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 ++ +IKK Y+KL+L +HPDK A EAF++++KA++ + +R Y Sbjct 125 TDTEIKKSYKKLALQLHPDKNHAPSADEAFKMVSKAFQVLSDPNLRAHY 173 > At2g01710 Length=311 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 26/34 (76%), Gaps = 0/34 (0%) Query 5 IKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYE 38 IKKQYR+L+L++HPDK + A +AF+ + A+E Sbjct 91 IKKQYRRLALLLHPDKNRFPFADQAFRFVLDAWE 124 > 7295437 Length=334 Score = 42.4 bits (98), Expect = 2e-04, Method: Composition-based stats. Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 0/46 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVR 46 S+++IKK YRKL+L HPDK K A+E F+ + +AYE ++ R Sbjct 16 SDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKR 61 > Hs22046868 Length=317 Score = 42.0 bits (97), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S+E++KK YRKL+L HPDK A +AF+ + A+ RLRY Sbjct 53 SDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRY 101 > At2g25560 Length=656 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 34/48 (70%), Gaps = 0/48 (0%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 +E ++K+YRKL++++HPD+ K A+EAF+ L++A+ ++ R Y Sbjct 79 DEIVRKRYRKLAVMLHPDRNKSVGAEEAFKFLSQAWGVFSDKAKRADY 126 > HsM6912422 Length=348 Score = 42.0 bits (97), Expect = 3e-04, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 0/58 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKK 58 +E++IKK YRK++L HPDK K A+E F+ + +AY+ + R Y EE K Sbjct 16 NEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLK 73 > 7299832 Length=370 Score = 41.6 bits (96), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 13/59 (22%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKKR 59 ++ +IKK Y+KL+L +HPDK K A EAF+ L A AGV+ +A+KR Sbjct 118 TDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNA-------------AGVLTDAEKR 163 > Hs21361413 Length=348 Score = 41.6 bits (96), Expect = 4e-04, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 0/58 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKK 58 +E++IKK YRK++L HPDK K A+E F+ + +AY+ + R Y EE K Sbjct 16 NEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLK 73 > At2g35540 Length=575 Score = 41.6 bits (96), Expect = 4e-04, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 30/40 (75%), Gaps = 0/40 (0%) Query 5 IKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEG 44 IK+QYRKL+L++HPDK + +E F++LN+A+ ++G Sbjct 87 IKQQYRKLALVLHPDKNPYVGCEEGFKLLNEAFRVFSDKG 126 > Hs7706495 Length=358 Score = 41.2 bits (95), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 27/59 (45%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHEL-AQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKK 58 S +DIKK YRKL+L +HPD+ + AQE FQ L AYE + R +Y EE K Sbjct 37 SIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLK 95 > At5g53150 Length=755 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S+E +KKQYRKL L++HPDK K + A+ AF ++ +A+ ++ R+ Y Sbjct 78 SDEALKKQYRKLVLMLHPDKNKCKGAEGAFNLVAEAWALLSDKDKRILY 126 > CE27221 Length=784 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 4/47 (8%) Query 1 SEEDIKKQYRKLSLIIHPDKCKH----ELAQEAFQVLNKAYEKAQEE 43 + + IKK YRK L++HPDK LA+ AF LN AY K Q + Sbjct 734 TPDQIKKHYRKACLVVHPDKLTGSPHLSLAKMAFTELNDAYSKYQND 780 > YOR254c Length=663 Score = 40.4 bits (93), Expect = 8e-04, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 7/56 (12%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELA-------QEAFQVLNKAYEKAQEEGVRLRY 49 S+ DIK YRKLS+ HPDK L +E + + KAYE +E VR Y Sbjct 137 SDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNY 192 > Hs8923030 Length=375 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S+ED+KK YR+L+L HPDK A EAF+ + AY R +Y Sbjct 122 SDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQY 170 > At2g35720 Length=537 Score = 40.0 bits (92), Expect = 0.001, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 4/53 (7%) Query 1 SEEDIKKQYRKLSLIIHPDKCK----HELAQEAFQVLNKAYEKAQEEGVRLRY 49 S+E+I+K YR+ + + HPDK + E+A E FQ + +AYE +E RL Y Sbjct 26 SDEEIRKAYRQWAQVYHPDKIQSPQMKEVATENFQRICEAYEILSDETKRLIY 78 > 7296521 Length=128 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYE 38 S ED+KK YR+++L HPDK H A+E F+ + A+E Sbjct 16 SSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFE 53 > Hs18554003 Length=232 Score = 39.7 bits (91), Expect = 0.001, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Query 1 SEEDIKKQYRKLSLIIHPDKC--KHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S EDIKK YRKL+L HPDK E A++ F+++++AYE + R Y Sbjct 15 SPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLY 65 > At4g19570 Length=539 Score = 39.7 bits (91), Expect = 0.001, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 34/48 (70%), Gaps = 0/48 (0%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 +E +KK+YRKL+L++HPDK + A+ AF+++ +A++ ++ R Y Sbjct 79 DEAVKKRYRKLALLLHPDKNRFTGAEGAFKLILEAWDLLSDKSQRSSY 126 > CE24236 Length=365 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 0/49 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 S ++I+ +RK +HPDKCKH A EA +V+N A+ + R +Y Sbjct 39 SPDEIRIAFRKRIREVHPDKCKHPSATEASKVVNNAFSLLMDPAKRRQY 87 > At3g04980 Length=1165 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 32/47 (68%), Gaps = 0/47 (0%) Query 3 EDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 + IKKQYRKL+L++HPDK K A+ AF+++ +A ++ R +Y Sbjct 62 DTIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIKRSQY 108 > At4g19590 Length=345 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 28/36 (77%), Gaps = 0/36 (0%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAY 37 EE +KKQY++L+L++HPDK E A+ AF+++ A+ Sbjct 69 EEVVKKQYKRLALLLHPDKNNCEGAEGAFKLVLAAW 104 > 7296101 Length=335 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 0/58 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKK 58 ++++IKK YRKL+L HPDK K A++ F+ + +AYE ++ R Y E+ K Sbjct 16 TDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLK 73 > At2g26890 Length=2535 Score = 38.9 bits (89), Expect = 0.002, Method: Composition-based stats. Identities = 19/40 (47%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQ 41 EE +K+QYRKL++ HPD K+ +E F + KAYE Q Sbjct 1519 EEKLKRQYRKLAMRYHPD--KNPEGREKFLAVQKAYECLQ 1556 > At4g19580 Length=301 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 17/35 (48%), Positives = 27/35 (77%), Gaps = 0/35 (0%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKA 36 EE +KKQY+KL+L++HPDK + A+ AF+++ A Sbjct 68 EEAVKKQYKKLALLLHPDKNRFNGAEGAFKLVRHA 102 > At5g16650 Length=128 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHE-LAQEAFQVLNKAYEKAQEEGVRLRY--AGVIE 54 +EE I+ YRKL+L HPDK K + A E FQ +N+AY + R Y G+ E Sbjct 23 TEELIRLNYRKLALKWHPDKHKGDSAATEKFQEINEAYNVLMDPAKRFEYDFTGIYE 79 > 7299418 Length=299 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 5/60 (8%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHEL---AQEAFQVLNKAYEKAQEEGVRLRY--AGVIEE 55 E+++KK Y KLSL++HPD+ E + E F+VL+K Y+ + R Y GVI++ Sbjct 27 GEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALYDEQGVIDD 86 > At5g18750 Length=884 Score = 38.5 bits (88), Expect = 0.003, Method: Compositional matrix adjust. Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 0/35 (0%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKA 36 E IKKQY+KL+L +HPDK K A+ AF+ + +A Sbjct 79 ENTIKKQYKKLALHLHPDKNKLPGAESAFKTIGEA 113 > At3g08970 Length=572 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 0/48 (0%) Query 2 EEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRY 49 + +I+K + K SL HPDK K + AQE F +N AYE +E R Y Sbjct 40 QREIQKAFHKQSLKYHPDKNKDKGAQEKFAEINNAYEILSDEEKRKNY 87 > CE03412 Length=331 Score = 38.5 bits (88), Expect = 0.003, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 0/58 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKK 58 ++++IKK YRK++L HPDK K A+ F+ + +AY+ ++ + Y EE K Sbjct 16 TDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIYDQFGEEGLK 73 > SPBC3E7.11c Length=355 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Query 3 EDIKKQYRKLSLIIHPDKCKH--ELAQEAFQVLNKAYEKAQEEGVRLRY 49 + IKK YR+L+++ HPDK + E A+E FQ L +AY+ + +R +Y Sbjct 23 DTIKKSYRRLAILYHPDKNRENPEAAREKFQKLAEAYQVLSDPKLREKY 71 > SPAC4H3.01 Length=392 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Query 4 DIKKQYRKLSLIIHPDKCKHEL--AQEAFQVLNKAYEKAQEEGVRLRY 49 DIKK YRKL++ HPDK + A E FQ +++AY+ +E +R +Y Sbjct 23 DIKKAYRKLAVKYHPDKNPDDPQGASEKFQKISEAYQVLGDEKLRSQY 70 > Hs20535925 Length=273 Score = 38.1 bits (87), Expect = 0.004, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 26/36 (72%), Gaps = 0/36 (0%) Query 1 SEEDIKKQYRKLSLIIHPDKCKHELAQEAFQVLNKA 36 S +++ K YRKL++++HPDKC +++AF+ + A Sbjct 229 SRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNA 264 > At5g49580 Length=695 Score = 38.1 bits (87), Expect = 0.004, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Query 5 IKKQYRKLSLIIHPDK-CKHELAQEAFQVLNKAYE 38 +K++YRK ++++HPDK +E A EAF+ L AYE Sbjct 426 LKREYRKKAMLVHPDKNMGNERAAEAFKKLQNAYE 460 > SPBC1734.05c Length=209 Score = 37.7 bits (86), Expect = 0.005, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Query 1 SEEDIKKQYRKLSLIIHPDKCK-HELAQEAFQVLNKAYEKAQEEGVR 46 S +DI+ YRK SL+IHPDK + + A +AF +L KA + +R Sbjct 43 SVDDIRNLYRKKSLMIHPDKNRDNPKAADAFDILKKAESDLVNDKIR 89 > At1g16680 Length=496 Score = 37.7 bits (86), Expect = 0.006, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query 5 IKKQYRKLSLIIHPDK-CKHELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKKR 59 +KK YRK ++++HPDK LA E+F+ L AYE + R Y ++++ + R Sbjct 251 LKKDYRKKAMLVHPDKNMGSPLASESFKKLQSAYEVLSDSVKRRDYDELLKKEESR 306 > 7291882 Length=540 Score = 37.7 bits (86), Expect = 0.006, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Query 4 DIKKQYRKLSLIIHPDKCKHELAQ--EAFQVLNKAYE 38 DIK YRK++L HPDK LA+ E FQ++ +AYE Sbjct 18 DIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYE 54 > At3g62600 Length=346 Score = 37.4 bits (85), Expect = 0.006, Method: Compositional matrix adjust. Identities = 26/60 (43%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query 1 SEEDIKKQYRKLSLIIHPDKCK-HELAQEAFQVLNKAYEKAQEEGVRLRYAGVIEEAKKR 59 S+E IK+ YRKL+L HPDK + +E A F +N AYE +E R Y EE K+ Sbjct 38 SDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSDEEKREIYNKYGEEGLKQ 97 Lambda K H 0.316 0.132 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178852562 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40