bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3268_orf1 Length=72 Score E Sequences producing significant alignments: (Bits) Value SPAC56F8.07 55.1 3e-08 YER143w 50.8 6e-07 7293232 42.7 2e-04 CE23513 34.3 0.063 Hs22056190 28.9 2.7 At1g22430 26.9 8.8 > SPAC56F8.07 Length=507 Score = 55.1 bits (131), Expect = 3e-08, Method: Composition-based stats. Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%) Query 3 ADKCSLASIIDKRFAGLTMGVGKAPIMGRVHVAPLKLGTKFCPC 46 A+KC L ++D RF G+ GVG A I+G VH APLK+G + PC Sbjct 315 AEKCGLTRLLDTRFQGVAKGVGMAKILGCVHSAPLKIGDLYLPC 358 > YER143w Length=428 Score = 50.8 bits (120), Expect = 6e-07, Method: Composition-based stats. Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 0/46 (0%) Query 2 FADKCSLASIIDKRFAGLTMGVGKAPIMGRVHVAPLKLGTKFCPCS 47 A K L+ +IDKRF G GVG I+GR+H A +K+ T++ PCS Sbjct 232 LAKKTGLSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQYIPCS 277 > 7293232 Length=458 Score = 42.7 bits (99), Expect = 2e-04, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Query 3 ADKCSLASIIDKRFAGLTMGVGKAPIMGRVHVAPLKLGTKFCPCSSYCFGGHQDAD 58 A++C + +ID R+ G+ GVG PI+GR+H+ L++ SS+ G Q D Sbjct 270 AERCHVNRLIDTRWNGVAKGVGTQPILGRIHMVQLQIENDHL-TSSFTVLGQQPMD 324 > CE23513 Length=389 Score = 34.3 bits (77), Expect = 0.063, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query 1 AFADKCSLASIIDKRFAGLTMGV-GKAPIMGRVHVAPLKLGTKFCPC 46 A A++C L +ID+RF + GV G I G++H+ +K+ C Sbjct 272 ACAERCGLNGLIDRRFQSMARGVGGTEKIEGKIHLCDVKVEDAHFSC 318 > Hs22056190 Length=1691 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 10/17 (58%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 43 FCPCSSYCFGGHQDADA 59 F PC++ C GGHQ+A A Sbjct 653 FTPCTATCVGGHQEAIA 669 > At1g22430 Length=388 Score = 26.9 bits (58), Expect = 8.8, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query 8 LASIIDKRFAGLTMGVGKAPIMG-RVHVAPLKLGT 41 LAS++++ F G GK ++G H AP+ LG+ Sbjct 283 LASLLNEAFISTRTGTGKTVMLGMEKHAAPISLGS 317 Lambda K H 0.324 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1190896168 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40