bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_3312_orf2 Length=98 Score E Sequences producing significant alignments: (Bits) Value CE25486 40.8 6e-04 7293868 39.3 0.002 Hs19526773 37.4 0.007 At5g61500 35.0 0.031 SPBC3B9.06c 33.9 0.085 At1g15940 30.0 1.1 YCR102c 29.6 1.4 At1g80810 28.9 2.7 Hs4505375 28.5 3.3 > CE25486 Length=305 Score = 40.8 bits (94), Expect = 6e-04, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 22/28 (78%), Gaps = 0/28 (0%) Query 62 RVNSWLPPDKQFLVTRGVACHRRVRDIE 89 ++ ++LP DKQFL+TR V CH+R + +E Sbjct 63 KIRTFLPIDKQFLITRNVPCHKRCKQME 90 > 7293868 Length=330 Score = 39.3 bits (90), Expect = 0.002, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 62 RVNSWLPPDKQFLVTRGVACHRRVRDIE 89 + +LP DKQFL+TR V C+RR + +E Sbjct 62 KTKPYLPKDKQFLITRNVPCYRRCKQME 89 > Hs19526773 Length=314 Score = 37.4 bits (85), Expect = 0.007, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 19/69 (27%) Query 33 GVCTPQRC----------CSIYLWGLGVYVHRREPAVGKRVNSWLPPDKQFLVTRGVACH 82 GV TP+ C + W G + +V ++LP KQFLVT+ V C+ Sbjct 32 GVITPEEFVAAGDHLVHHCPTWQWATGEEL---------KVKAYLPTGKQFLVTKNVPCY 82 Query 83 RRVRDIEAS 91 +R + +E S Sbjct 83 KRCKQMEYS 91 > At5g61500 Length=311 Score = 35.0 bits (79), Expect = 0.031, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Query 41 CSIYLWGLGVYVHRREPAVGKRVNSWLPPDKQFLVTRGVACHRRVRDIEASLNA 94 C + W G +R+P +LP DKQFL+TR V C RR + A Sbjct 49 CPTWSWESG-DASKRKP--------YLPSDKQFLITRNVPCLRRAASVAEDYEA 93 > SPBC3B9.06c Length=275 Score = 33.9 bits (76), Expect = 0.085, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query 60 GKRVNSWLPPDKQFLVTRGVACHRRVRDIEASLNAE 95 G R+ +LP DKQ+LVTR V C + R+I +N E Sbjct 55 GDRIRGFLPKDKQYLVTRHVFCVQ--RNINIGVNEE 88 > At1g15940 Length=1012 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 56 EPAVGKRVNSWLPPDKQF 73 E VGKRVN W P DK+F Sbjct 591 EELVGKRVNVWWPLDKKF 608 > YCR102c Length=368 Score = 29.6 bits (65), Expect = 1.4, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 6/69 (8%) Query 4 PAGKTRCVAAGADIVIAAASA-----FNIFVGF-WGVCTPQRCCSIYLWGLGVYVHRREP 57 PAG R + A I ++ +A +N+ + W TPQR I LWG V + Sbjct 125 PAGPVRSLEGAATIPVSLTTAGLVLTYNLGLNLKWEPSTPQRNGPILLWGGATAVGQSLI 184 Query 58 AVGKRVNSW 66 + ++N + Sbjct 185 QLANKLNGF 193 > At1g80810 Length=826 Score = 28.9 bits (63), Expect = 2.7, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 0/18 (0%) Query 56 EPAVGKRVNSWLPPDKQF 73 E VGKRVN W P DK F Sbjct 556 EDLVGKRVNIWWPLDKTF 573 > Hs4505375 Length=1461 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query 52 VHRREPAVGKRVNSWLPPDKQFLVTRGVA 80 +H R P V V SW PP+ Q +V RG A Sbjct 745 LHVR-PLVTSIVVSWTPPENQNIVVRGYA 772 Lambda K H 0.329 0.140 0.476 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194657780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40