bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_0016_orf1 Length=158 Score E Sequences producing significant alignments: (Bits) Value tpv:TP02_0678 eukaryotic translation initiation factor 2 subun... 142 6e-34 tgo:TGME49_035540 translation initiation factor 2 beta, putati... 136 3e-32 cpv:cgd8_4430 translation initiation factor if-2 betam beta su... 132 5e-31 bbo:BBOV_II007040 18.m06583; eukaryotic translation initiation... 129 4e-30 pfa:PF10_0103 eukaryotic translation initiation factor 2 beta,... 126 3e-29 mmu:67204 Eif2s2, 2810026E11Rik, 38kDa, AA408636, AA571381, AA... 86.7 3e-17 mmu:100040220 Gm9892; predicted gene 9892 86.7 hsa:8894 EIF2S2, DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC850... 86.7 3e-17 xla:779195 hypothetical protein MGC130708 85.5 7e-17 dre:324365 eif2s2, wu:fc26g03, wu:fu10f07, zgc:77084; eukaryot... 85.1 8e-17 ath:AT5G20920 EIF2 BETA; translation initiation factor; K03238... 84.7 1e-16 xla:779197 eif2s2, MGC130959; eukaryotic translation initiatio... 84.7 1e-16 xla:780741 eukaryote initiation factor 2 beta 84.7 1e-16 cel:K04G2.1 iftb-1; eIFTwoBeta (eIF2beta translation initiatio... 75.1 1e-13 ath:AT3G07920 translation initiation factor; K03238 translatio... 61.2 1e-09 sce:YPL237W SUI3; Beta subunit of the translation initiation f... 60.1 3e-09 ath:AT5G01940 eukaryotic translation initiation factor 2B fami... 50.1 3e-06 ath:AT5G22810 GDSL-motif lipase, putative 36.2 0.042 mmu:22283 Ush2a, A930011D15Rik, A930037M10Rik, Gm676, Gm983, M... 30.8 1.9 cpv:cgd7_420 protein with DEXDc plus ring plus HELICc; possibl... 29.6 4.0 dre:799852 si:ch211-219a4.6 28.5 9.2 dre:560477 ercc6; excision repair cross-complementing rodent r... 28.5 9.5 > tpv:TP02_0678 eukaryotic translation initiation factor 2 subunit beta; K03238 translation initiation factor 2 subunit 2 Length=241 Score = 142 bits (357), Expect = 6e-34, Method: Compositional matrix adjust. Identities = 71/152 (46%), Positives = 98/152 (64%), Gaps = 5/152 (3%) Query 7 SSSSSRRGSRNSSDSNTITIISNSAGRITTATSAASSNISSKQQHQQQQQQQHRGLCVSL 66 S +S + ++S + ++N + T + S + ++++ R ++ Sbjct 5 SDVTSEKSPKDSPEEEVTDKLNNMGLKPETQDPKPADAKDSPPKFNFGEKKKKR----TV 60 Query 67 FAADAAAAEGFIDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKRYTIKPPQVVR 126 A D+ E IDG+GQ+F++GHV YEE+L+RIQ +I NNPDL+GSKRYTIKPPQVVR Sbjct 61 DAGDSPKTE-IIDGTGQVFVKGHVYPYEELLARIQSMINANNPDLSGSKRYTIKPPQVVR 119 Query 127 VGSKKVAWINFKDICGIMHRPSEHVLQFVLAE 158 VGSKKVAWINF+DIC IM R +HV QFVLAE Sbjct 120 VGSKKVAWINFRDICSIMGRSMDHVHQFVLAE 151 > tgo:TGME49_035540 translation initiation factor 2 beta, putative ; K03238 translation initiation factor 2 subunit 2 Length=231 Score = 136 bits (343), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 62/82 (75%), Positives = 70/82 (85%), Gaps = 0/82 (0%) Query 77 FIDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKRYTIKPPQVVRVGSKKVAWIN 136 IDG+G+LF RG SY+EML RIQ LI K+NPDL+G+KRYTIKPPQVVRVGSKKVAWIN Sbjct 59 IIDGTGELFKRGKEYSYQEMLQRIQTLIEKHNPDLSGAKRYTIKPPQVVRVGSKKVAWIN 118 Query 137 FKDICGIMHRPSEHVLQFVLAE 158 FKDIC IM+R +HV QFVLAE Sbjct 119 FKDICNIMNRQPDHVHQFVLAE 140 > cpv:cgd8_4430 translation initiation factor if-2 betam beta subunit ZnR ; K03238 translation initiation factor 2 subunit 2 Length=214 Score = 132 bits (332), Expect = 5e-31, Method: Compositional matrix adjust. Identities = 54/82 (65%), Positives = 72/82 (87%), Gaps = 0/82 (0%) Query 77 FIDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKRYTIKPPQVVRVGSKKVAWIN 136 ++DGSGQLF++G + YEE+L R++ LI+++NPDL G+KRYT+KPPQVVRVGSKKVAWIN Sbjct 42 YVDGSGQLFVKGAIYPYEELLERVRRLILEHNPDLWGAKRYTLKPPQVVRVGSKKVAWIN 101 Query 137 FKDICGIMHRPSEHVLQFVLAE 158 F++IC IM R ++HV QFVL+E Sbjct 102 FQEICNIMQRNADHVFQFVLSE 123 > bbo:BBOV_II007040 18.m06583; eukaryotic translation initiation factor 2, beta; K03238 translation initiation factor 2 subunit 2 Length=238 Score = 129 bits (324), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 60/91 (65%), Positives = 76/91 (83%), Gaps = 1/91 (1%) Query 68 AADAAAAEGFIDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKRYTIKPPQVVRV 127 A+D+ +E IDGSGQ+F+RGHV YEE+L+RIQ LI ++ DL+G+K+YTI+PPQVVRV Sbjct 59 ASDSVKSE-VIDGSGQVFVRGHVYQYEELLNRIQTLINAHSHDLSGNKKYTIRPPQVVRV 117 Query 128 GSKKVAWINFKDICGIMHRPSEHVLQFVLAE 158 GSKKVAWINFK++C IM R +HV QFVLAE Sbjct 118 GSKKVAWINFKELCNIMGRTMDHVHQFVLAE 148 > pfa:PF10_0103 eukaryotic translation initiation factor 2 beta, putative; K03238 translation initiation factor 2 subunit 2 Length=222 Score = 126 bits (317), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 59/81 (72%), Positives = 67/81 (82%), Gaps = 0/81 (0%) Query 78 IDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSKRYTIKPPQVVRVGSKKVAWINF 137 IDG+G++F RG V Y+E+L RIQDLI K+N DL SK+YTIKPPQVVRVGSKKVAWINF Sbjct 50 IDGTGKVFERGAVYPYDELLHRIQDLINKHNIDLCISKKYTIKPPQVVRVGSKKVAWINF 109 Query 138 KDICGIMHRPSEHVLQFVLAE 158 KDIC IM+R EHV FVLAE Sbjct 110 KDICTIMNRNEEHVFHFVLAE 130 > mmu:67204 Eif2s2, 2810026E11Rik, 38kDa, AA408636, AA571381, AA986487, AW822225, D2Ertd303e, EIF2, EIF2B, MGC130606; eukaryotic translation initiation factor 2, subunit 2 (beta); K03238 translation initiation factor 2 subunit 2 Length=331 Score = 86.7 bits (213), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 36/69 (52%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +YEE+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 173 TYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 232 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 233 HLLAFLLAE 241 > mmu:100040220 Gm9892; predicted gene 9892 Length=331 Score = 86.7 bits (213), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 35/69 (50%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +YEE+L+R+ +++ + NPD+ AG KR + +KPPQV+RVG+KK +++NF DIC ++HR + Sbjct 173 TYEELLNRVLNIMREKNPDMVAGEKRKFVMKPPQVIRVGTKKTSFVNFTDICKLLHRQPK 232 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 233 HLLAFLLAE 241 > hsa:8894 EIF2S2, DKFZp686L18198, EIF2, EIF2B, EIF2beta, MGC8508; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; K03238 translation initiation factor 2 subunit 2 Length=333 Score = 86.7 bits (213), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 36/69 (52%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +YEE+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 175 TYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 234 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 235 HLLAFLLAE 243 > xla:779195 hypothetical protein MGC130708 Length=332 Score = 85.5 bits (210), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 35/69 (50%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +Y+E+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 174 TYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 233 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 234 HLLAFLLAE 242 > dre:324365 eif2s2, wu:fc26g03, wu:fu10f07, zgc:77084; eukaryotic translation initiation factor 2, subunit 2 beta; K03238 translation initiation factor 2 subunit 2 Length=327 Score = 85.1 bits (209), Expect = 8e-17, Method: Compositional matrix adjust. Identities = 35/69 (50%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +Y+E+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 169 TYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 228 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 229 HLLVFLLAE 237 > ath:AT5G20920 EIF2 BETA; translation initiation factor; K03238 translation initiation factor 2 subunit 2 Length=268 Score = 84.7 bits (208), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 33/67 (49%), Positives = 53/67 (79%), Gaps = 1/67 (1%) Query 93 YEEMLSRIQDLIVKNNPDLAGSKRYTI-KPPQVVRVGSKKVAWINFKDICGIMHRPSEHV 151 Y+E+L R+ +++ +NNP+LAG +R T+ +PPQV+R G+KK ++NF D+C MHR +HV Sbjct 118 YDELLGRVFNILRENNPELAGDRRRTVMRPPQVLREGTKKTVFVNFMDLCKTMHRQPDHV 177 Query 152 LQFVLAE 158 +Q++LAE Sbjct 178 MQYLLAE 184 > xla:779197 eif2s2, MGC130959; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; K03238 translation initiation factor 2 subunit 2 Length=335 Score = 84.7 bits (208), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 35/69 (50%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +Y+E+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 177 TYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 236 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 237 HLLAFLLAE 245 > xla:780741 eukaryote initiation factor 2 beta Length=335 Score = 84.7 bits (208), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 35/69 (50%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Query 92 SYEEMLSRIQDLIVKNNPDL-AGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 +Y+E+L+R+ +++ + NPD+ AG KR + +KPPQVVRVG+KK +++NF DIC ++HR + Sbjct 177 TYDELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPK 236 Query 150 HVLQFVLAE 158 H+L F+LAE Sbjct 237 HLLAFLLAE 245 > cel:K04G2.1 iftb-1; eIFTwoBeta (eIF2beta translation initiation factor) family member (iftb-1); K03238 translation initiation factor 2 subunit 2 Length=250 Score = 75.1 bits (183), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Query 92 SYEEMLSRIQDLIVKNNPDLAGSKR-YTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEH 150 +YEE L+ + ++ NPD AG K+ + IK P+V R GSKK A+ NF +IC +M R +H Sbjct 88 TYEEALTLVYQVMKDKNPDFAGDKKKFAIKLPEVARAGSKKTAFSNFLEICRLMKRQDKH 147 Query 151 VLQFVLAE 158 VLQF+LAE Sbjct 148 VLQFLLAE 155 > ath:AT3G07920 translation initiation factor; K03238 translation initiation factor 2 subunit 2 Length=164 Score = 61.2 bits (147), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 5/70 (7%) Query 94 EEMLSRIQDLIVKNNPDLAGSKRYTI-KPPQVVR----VGSKKVAWINFKDICGIMHRPS 148 +E+L R+ +++ +N+P+L G TI PPQV+R G+KK ++NF D C MHR Sbjct 17 QEILRRVFNILRENSPELVGIWLLTIIWPPQVLREETAKGTKKTVFVNFMDYCKTMHRNP 76 Query 149 EHVLQFVLAE 158 +HV+ F+LAE Sbjct 77 DHVMAFLLAE 86 > sce:YPL237W SUI3; Beta subunit of the translation initiation factor eIF2, involved in the identification of the start codon; proposed to be involved in mRNA binding; K03238 translation initiation factor 2 subunit 2 Length=285 Score = 60.1 bits (144), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Query 93 YEEMLSRIQDLIVKNNPDLAGSK---RYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSE 149 Y E+LSR +++ NNP+LAG + ++ I PP +R G KK + N +DI +HR E Sbjct 131 YSELLSRFFNILRTNNPELAGDRSGPKFRIPPPVCLRDG-KKTIFSNIQDIAEKLHRSPE 189 Query 150 HVLQFVLAE 158 H++Q++ AE Sbjct 190 HLIQYLFAE 198 > ath:AT5G01940 eukaryotic translation initiation factor 2B family protein / eIF-2B family protein; K03238 translation initiation factor 2 subunit 2 Length=231 Score = 50.1 bits (118), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 23/67 (34%), Positives = 44/67 (65%), Gaps = 2/67 (2%) Query 93 YEEMLSRIQDLIVKNNPDLAGSK-RYTIKPPQVVRVGSKKVAWINFKDICGIMHRPSEHV 151 Y+E+LS + D + + + +++ + R + PPQ++ G+ V +NF D+C MHR +HV Sbjct 75 YKELLSMVFDRLREEDVEVSTERPRTVMMPPQLLAEGTITVC-LNFADLCRTMHRKPDHV 133 Query 152 LQFVLAE 158 ++F+LA+ Sbjct 134 MKFLLAQ 140 > ath:AT5G22810 GDSL-motif lipase, putative Length=337 Score = 36.2 bits (82), Expect = 0.042, Method: Compositional matrix adjust. Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 4/76 (5%) Query 37 ATSAASSNISSKQQHQQQQQQQHRGLCVSLFAADAAAAEGFIDGSGQLF----IRGHVCS 92 AT + N+ K Q ++ +G + + A A+AA G+ DG+ +L+ + + Sbjct 59 ATDFTAENLGFKSYPQAYLSKKAKGKNLLIGANFASAASGYYDGTAKLYSAISLPQQLEH 118 Query 93 YEEMLSRIQDLIVKNN 108 Y++ +SRIQ++ NN Sbjct 119 YKDYISRIQEIATSNN 134 > mmu:22283 Ush2a, A930011D15Rik, A930037M10Rik, Gm676, Gm983, Mush2a, Usherin; Usher syndrome 2A (autosomal recessive, mild) homolog (human) Length=5193 Score = 30.8 bits (68), Expect = 1.9, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 13/65 (20%) Query 29 NSAGRITTATSAASSNISSKQQHQQQQQQQHRGLCVSLFAADAAAAEGFIDGSGQLFIRG 88 N AG +T++ +N S+K++ Q Q +LF+ D+ A+ ++D SG + G Sbjct 4904 NEAG----STASGWTNFSTKKEMPQYQ---------ALFSVDSNASMVWVDWSGTFLLNG 4950 Query 89 HVCSY 93 H+ Y Sbjct 4951 HLKEY 4955 > cpv:cgd7_420 protein with DEXDc plus ring plus HELICc; possible SNF2 domain Length=2042 Score = 29.6 bits (65), Expect = 4.0, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 2 SSNENSSSSSRRGSRNSSDSNTITIISNSAGRITTATSAAS 42 +SN +S++S + NS+ +N+ T SN+A ITT +S S Sbjct 323 NSNTANSNTSNSNTANSNTANSNTSNSNTANSITTTSSNCS 363 > dre:799852 si:ch211-219a4.6 Length=840 Score = 28.5 bits (62), Expect = 9.2, Method: Compositional matrix adjust. Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 1/91 (1%) Query 56 QQQHRGLCVSLFAADAAAAEGFIDGSGQLFIRGHVCSYEEMLSRIQDLIVKNNPDLAGSK 115 Q++H L D E F G+G + I G ++ ++ K D A ++ Sbjct 526 QKEHEFLLTLQAVFDVRIEEFFRSGNGGITITGSPSGVSCAAIEVESMLCKAQNDFARAE 585 Query 116 RYTIKPPQVVRVGSKKVAWINFKDICGIMHR 146 I VVR K+ WI +I GI+ + Sbjct 586 ERDIL-YSVVRWSCKEEPWIQTPEISGILEK 615 > dre:560477 ercc6; excision repair cross-complementing rodent repair deficiency, complementation group 6; K10841 DNA excision repair protein ERCC-6 Length=1390 Score = 28.5 bits (62), Expect = 9.5, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Query 2 SSNENSSSSSRRGSRNSSDS--NTITIISNSAGRITTATSAASSNISSKQQHQQQQQ 56 S N N++S + + N+S+S N + SN+ G +T++TS A S+++S Q+H+++++ Sbjct 1033 SGNRNTTSVNGLPNNNTSESPNNKLESRSNANG-LTSSTSKALSSMNSPQKHREKKK 1088 Lambda K H 0.314 0.126 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3582056500 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40