bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_0035_orf2 Length=122 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_027370 X-Pro dipeptidyl-peptidase domain-containing... 133 1e-31 cpv:cgd1_1100 alpha beta hydrolase with 5 transmembrane domain... 84.0 1e-16 cel:Y11D7A.8 hypothetical protein 32.3 0.41 ath:AT1G66230 MYB20; MYB20 (myb domain protein 20); DNA bindin... 29.6 2.2 mmu:208618 Etl4, 6620402G01Rik, 9430077C05Rik, BC026657, E3300... 29.6 2.3 ath:AT1G61840 DC1 domain-containing protein 28.9 4.3 ath:AT2G02700 DC1 domain-containing protein 28.5 5.3 cpv:cgd3_3600 hypothetical protein 27.7 8.7 > tgo:TGME49_027370 X-Pro dipeptidyl-peptidase domain-containing protein (EC:3.4.14.11); K06978 Length=1177 Score = 133 bits (335), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 53/102 (51%), Positives = 75/102 (73%), Gaps = 0/102 (0%) Query 2 MQKNAPESRPQLILGNWSHGGRRSCDPFGGSFSCFESDLYKTILRFFDCRLKKKCWGGVE 61 M++NAPESR +L+LG+WSHGGRRSC P+ GSF CFE+D Y +RFFDC LK +CWG + Sbjct 507 MKRNAPESRSKLLLGSWSHGGRRSCSPYAGSFPCFEADQYLDAVRFFDCHLKGQCWGNIN 566 Query 62 EEMPVHYWQTGTAEWREALTFPPRENMKNFDLRLTDKRLSDV 103 +E VHYWQ G+ EWR + +PP +M+ D L++++ ++ Sbjct 567 DEPSVHYWQVGSEEWRTSEYYPPARHMRYVDFHLSNEKFVNL 608 > cpv:cgd1_1100 alpha beta hydrolase with 5 transmembrane domains ; K06978 Length=1103 Score = 84.0 bits (206), Expect = 1e-16, Method: Composition-based stats. Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 4/81 (4%) Query 6 APESRP--QLILGNWSHGGRRSCDPFGGSFSCFESDLYKTILRFFDCRLKKKCWGGVEEE 63 A + +P +L+LG W+H GR SC PFG S SCFE LY ++RF DC LK CW ++ Sbjct 736 ASKEKPIYKLVLGPWTHSGRASCSPFGKSISCFEPALYYDLVRFMDCALKGICWE--NQD 793 Query 64 MPVHYWQTGTAEWREALTFPP 84 +H++Q G +W FPP Sbjct 794 KNIHFFQVGEEKWYTTDKFPP 814 > cel:Y11D7A.8 hypothetical protein Length=469 Score = 32.3 bits (72), Expect = 0.41, Method: Composition-based stats. Identities = 25/110 (22%), Positives = 44/110 (40%), Gaps = 1/110 (0%) Query 2 MQKNAPESRPQLILGNWSHGGRRSCDPFGGSFSCFESDLYKTILRFFDCRLKKKCWGGVE 61 ++K++ E +++ + S G+ DP G DL K I LK W + Sbjct 217 IKKHSKEGSGVVVMEDVSEKGQEQ-DPVKGLMLEVVRDLLKQIAYLHSISLKHTSWSTLV 275 Query 62 EEMPVHYWQTGTAEWREALTFPPRENMKNFDLRLTDKRLSDVQLEEGPEE 111 ++P Y+ + + LTF R+++ + K SD L E Sbjct 276 ADLPPSYYAHTIGSFDDTLTFFERQDVDHSRFVHIGKYFSDEYLHSTATE 325 > ath:AT1G66230 MYB20; MYB20 (myb domain protein 20); DNA binding / transcription factor; K09422 myb proto-oncogene protein, plant Length=282 Score = 29.6 bits (65), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Query 61 EEEMPVHYWQTGTAEWREALTFPPRENMKN---FDLRLTDKRLSDVQLEEGPEEAFSVRN 117 E+E P+ Q T ++E + P N+KN + L D + ++ LE G E+ + Sbjct 135 EDEEPLKKLQNNTVPFQETMERPLENNIKNISRLEESLGDDQFMEINLEYGVEDVPLIET 194 Query 118 EGL 120 E L Sbjct 195 ESL 197 > mmu:208618 Etl4, 6620402G01Rik, 9430077C05Rik, BC026657, E330027G05Rik, Etl-4, Skt; enhancer trap locus 4 Length=1997 Score = 29.6 bits (65), Expect = 2.3, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query 77 REALTFPPRENMKNFDLRLTDKRLSDVQLEEGPE 110 R T PP+E KN + D R SDV+ E GP+ Sbjct 1220 RAGATAPPKEK-KNLEFYHEDVRKSDVECENGPQ 1252 > ath:AT1G61840 DC1 domain-containing protein Length=814 Score = 28.9 bits (63), Expect = 4.3, Method: Composition-based stats. Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Query 18 WSHG-GRRSCDPFGGSFSCFESDLYKTILRFFDCRLKKKCWGGVEEE 63 WS G R+S D G+++C + Y +R C L+K W GVE E Sbjct 466 WSCGVCRKSIDGDYGAYTCEKCKDYVVHVR---CALRKDVWDGVELE 509 > ath:AT2G02700 DC1 domain-containing protein Length=499 Score = 28.5 bits (62), Expect = 5.3, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Query 16 GNWSHG-GRRSCDPFGGSFSCFESDLYKTILRFFDCRLKKKCWGGVEEE 63 G W G RR D G++SC Y R C L+K W G+E E Sbjct 291 GKWCCGICRREIDSDYGAYSCNVCKDYAVHTR---CALRKDIWDGIELE 336 > cpv:cgd3_3600 hypothetical protein Length=526 Score = 27.7 bits (60), Expect = 8.7, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query 2 MQKNAPESRPQLILGNWSHGGRRSCDPFGG-SFSCFESDLYKTILRFFDCRLKKK 55 ++KN+P R + L G C FGG +C++SD Y +R F C + K Sbjct 292 IEKNSPSPRQRNSLTTIPGG---KCLLFGGYDGNCWKSDTYLLDIRKFSCSMHSK 343 Lambda K H 0.319 0.137 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2008132680 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40