bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_0384_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_068370 hypothetical protein ; K08874 transformation... 86.3 4e-17 cpv:cgd6_1740 Tra1p-like; C-terminal FAT domain plus phoshoino... 58.9 5e-09 pfa:MAL13P1.19 peptidase, putative 37.4 0.018 > tgo:TGME49_068370 hypothetical protein ; K08874 transformation/transcription domain-associated protein Length=8430 Score = 86.3 bits (212), Expect = 4e-17, Method: Compositional matrix adjust. Identities = 39/69 (56%), Positives = 51/69 (73%), Gaps = 0/69 (0%) Query 25 LNRLLLRHNPSRRRGLAFPLSAQVSIHPRCRLLEDMPSCITLQQILNEASRAAAEPMKQD 84 +N+LL + +R RGL+F L AQ+ +HPRCRL+ED PS +TLQ+IL E S + +E D Sbjct 7957 INQLLFKFKDTRGRGLSFTLHAQIPVHPRCRLMEDPPSLLTLQEILQEVSASGSETCLVD 8016 Query 85 PDLPVLLHR 93 PDLPVLLHR Sbjct 8017 PDLPVLLHR 8025 > cpv:cgd6_1740 Tra1p-like; C-terminal FAT domain plus phoshoinositide 3-kinase domain; very large protein ; K08874 transformation/transcription domain-associated protein Length=5542 Score = 58.9 bits (141), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 48/77 (62%), Gaps = 3/77 (3%) Query 22 QLQLNRLLLRHNPSRRRGLAFPLSAQVSIHPRCRLLEDMPSCITLQQILNEASRAA--AE 79 Q+ LN LL ++ +R R ++F + + +HPRCR++ED + + ++ E + ++ Sbjct 5179 QVTLNTLLYKYKETRSRNISFAIQPCIPLHPRCRIIEDTGNKKSFTELFEEEANSSNCTC 5238 Query 80 PMKQDPDLPVLLHRKMM 96 P+K D D P+LLHRK++ Sbjct 5239 PIK-DLDFPILLHRKLI 5254 > pfa:MAL13P1.19 peptidase, putative Length=9271 Score = 37.4 bits (85), Expect = 0.018, Method: Composition-based stats. Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Query 22 QLQLNRLLLRHNPSRRRGLAFPLSAQVSIHPRCRLLEDMPSCITLQQILNEASRAAAEPM 81 Q+ LN ++ + +++RGL+F ++ IHP L E ITL ++ NE + Sbjct 8551 QVLLNNIMFNFSQTKKRGLSFKINFNTQIHPNIILKEQPKDDITLHEVYNEYI-SVLRSD 8609 Query 82 KQDPDLPVLLHRKMMAHEISSKMLQ 106 K D +L HR ++ + +L+ Sbjct 8610 KYSMDNIMLYHRNLVQSSLHRLLLK 8634 Lambda K H 0.315 0.123 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3068761412 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40