bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1002_orf2 Length=97 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_116520 1,4-alpha-glucan branching enzyme, putative ... 137 1e-32 cpv:cgd6_3280 glycogen branching enzyme (1,4-alpha-glucan bran... 121 7e-28 eco:b3432 glgB, ECK3418, JW3395; 1,4-alpha-glucan branching en... 45.8 3e-05 ath:AT3G20440 EMB2729; alpha-amylase/ catalytic/ cation binding 39.7 0.003 sce:YEL011W GLC3, GHA1; Glc3p (EC:2.4.1.18); K00700 1,4-alpha-... 33.9 0.12 hsa:2632 GBE1, GBE; glucan (1,4-alpha-), branching enzyme 1 (E... 30.8 1.0 cel:T04A8.7 hypothetical protein; K00700 1,4-alpha-glucan bran... 30.0 1.7 tgo:TGME49_105860 calcium-dependent protein kinase 1, putative... 29.6 2.5 cel:C10B5.1 hypothetical protein 29.3 3.1 mmu:74185 Gbe1, 2310045H19Rik, 2810426P10Rik, D16Ertd536e; glu... 28.5 5.0 ath:AT5G03650 SBE2.2; SBE2.2 (starch branching enzyme 2.2); 1,... 28.1 7.2 dre:100148642 phosphatidylinositol glycan, class V-like 27.7 8.6 > tgo:TGME49_116520 1,4-alpha-glucan branching enzyme, putative (EC:2.4.1.18); K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=972 Score = 137 bits (344), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 57/72 (79%), Positives = 66/72 (91%), Gaps = 0/72 (0%) Query 1 GDDETWNFKWTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSPQAYYRYPVGVPHGGEWQL 60 GDDE WNFKWTDCDN+ DC++AFLRSY W+NDILVVCNFSP YYRYP+GVPHGGEW++ Sbjct 802 GDDEPWNFKWTDCDNSKDCVIAFLRSYMDWYNDILVVCNFSPNVYYRYPIGVPHGGEWEV 861 Query 61 LLNSDDWKYAGG 72 +LNSDDW+YAGG Sbjct 862 ILNSDDWRYAGG 873 > cpv:cgd6_3280 glycogen branching enzyme (1,4-alpha-glucan branching enzyme) ; K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=1030 Score = 121 bits (303), Expect = 7e-28, Method: Composition-based stats. Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 0/72 (0%) Query 1 GDDETWNFKWTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSPQAYYRYPVGVPHGGEWQL 60 GDDE+WNF+W DC+N+ DCI+AFLR Y+ W+ND++VVCNFS + Y YP+GVPHG EW + Sbjct 912 GDDESWNFQWVDCENSQDCIIAFLRKYKEWYNDVVVVCNFSSRRYNHYPIGVPHGKEWLV 971 Query 61 LLNSDDWKYAGG 72 +LNSDDWKY G Sbjct 972 MLNSDDWKYGGA 983 > eco:b3432 glgB, ECK3418, JW3395; 1,4-alpha-glucan branching enzyme (EC:2.4.1.18); K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=728 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 1/74 (1%) Query 2 DDETWNFKWTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSPQAYYRYPVGVPHGGEWQLL 61 D + + F+W D+ ++ F+R + N+I+V NF+P + Y G+ G+W+ + Sbjct 620 DFDPYGFEWLVVDDKERSVLIFVRR-DKEGNEIIVASNFTPVPRHDYRFGINQPGKWREI 678 Query 62 LNSDDWKYAGGCAA 75 LN+D Y G A Sbjct 679 LNTDSMHYHGSNAG 692 > ath:AT3G20440 EMB2729; alpha-amylase/ catalytic/ cation binding Length=899 Score = 39.7 bits (91), Expect = 0.003, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 7/58 (12%) Query 15 NNNDCIVAFLRSYEFWFNDILVVCNFSP-QAYYRYPVGVPHGGEWQLLLNSDDWKYAG 71 N+ + +++F R L + NF P +Y +Y VGV GE+ ++LNSD+ KY G Sbjct 803 NDANMVISFSRG------PFLFIFNFHPSNSYEKYDVGVEEAGEYTMILNSDEVKYGG 854 > sce:YEL011W GLC3, GHA1; Glc3p (EC:2.4.1.18); K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=704 Score = 33.9 bits (76), Expect = 0.12, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query 29 FWFNDILVVCNFSP-QAYYRYPVGVPHGGEWQLLLNSDDWKYAG 71 F N++L + NF P +Y Y VGV G + ++LNSD ++ G Sbjct 621 FERNNLLFIFNFHPTNSYSDYRVGVEKAGTYHIVLNSDRAEFGG 664 > hsa:2632 GBE1, GBE; glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18); K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=702 Score = 30.8 bits (68), Expect = 1.0, Method: Compositional matrix adjust. Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 7/63 (11%) Query 10 WTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSP-QAYYRYPVGVPHGGEWQLLLNSDDWK 68 + + + I+AF R+ +L + NF P ++Y Y VG G+++++L+SD + Sbjct 603 YVSEKHEGNKIIAFERA------GLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAE 656 Query 69 YAG 71 Y G Sbjct 657 YGG 659 > cel:T04A8.7 hypothetical protein; K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=681 Score = 30.0 bits (66), Expect = 1.7, Method: Compositional matrix adjust. Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 7/65 (10%) Query 8 FKWTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSP-QAYYRYPVGVPHGGEWQLLLNSDD 66 + +T ++ D + F R ++ V N P +++ Y +GV G +++ LNSD+ Sbjct 582 YAYTSWKHDGDKTIVFERG------GLVFVINLHPTKSFADYSIGVNTPGRYRIALNSDE 635 Query 67 WKYAG 71 K+ G Sbjct 636 SKFGG 640 > tgo:TGME49_105860 calcium-dependent protein kinase 1, putative (EC:2.7.11.17); K13412 calcium-dependent protein kinase [EC:2.7.11.1] Length=537 Score = 29.6 bits (65), Expect = 2.5, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 0/22 (0%) Query 2 DDETWNFKWTDCDNNNDCIVAF 23 DDETW+ +CD NND V F Sbjct 499 DDETWHQVLQECDKNNDGEVDF 520 > cel:C10B5.1 hypothetical protein Length=311 Score = 29.3 bits (64), Expect = 3.1, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 70 AGGCAAWAMAPISTQLRAAGWDGPI 94 A GC+A + +P S Q+ A WDG I Sbjct 236 AAGCSAISFSPNSKQIIAGFWDGSI 260 > mmu:74185 Gbe1, 2310045H19Rik, 2810426P10Rik, D16Ertd536e; glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18); K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=702 Score = 28.5 bits (62), Expect = 5.0, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query 34 ILVVCNFSP-QAYYRYPVGVPHGGEWQLLLNSDDWKYAG 71 +L + NF P ++Y Y VG G+++++L+SD +Y G Sbjct 621 LLFIFNFHPSKSYTDYRVGTATPGKFKIVLDSDAAEYGG 659 > ath:AT5G03650 SBE2.2; SBE2.2 (starch branching enzyme 2.2); 1,4-alpha-glucan branching enzyme (EC:2.4.1.18); K00700 1,4-alpha-glucan branching enzyme [EC:2.4.1.18] Length=805 Score = 28.1 bits (61), Expect = 7.2, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query 25 RSYEFWFNDILVVCNFS-PQAYYRYPVGVPHGGEWQLLLNSDDWKYAG 71 R F D++ V NF +Y+ Y +G G+++++L+SDD + G Sbjct 716 RVIVFERGDLVFVFNFHWTSSYFDYRIGCSKPGKYKIVLDSDDPLFGG 763 > dre:100148642 phosphatidylinositol glycan, class V-like Length=523 Score = 27.7 bits (60), Expect = 8.6, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query 10 WTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSP 42 W C CI+ + SY WF + + CNF P Sbjct 491 WKTCSIYTQCILGYFISY--WFLGLALHCNFLP 521 Lambda K H 0.322 0.140 0.520 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2055684140 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40