bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1239_orf1 Length=75 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_110280 phosphoethanolamine cytidylyltransferase, pu... 73.9 1e-13 pfa:PF13_0253 ethanolamine-phosphate cytidylyltransferase, put... 52.4 4e-07 hsa:5833 PCYT2, ET; phosphate cytidylyltransferase 2, ethanola... 47.8 9e-06 xla:444649 pcyt2, MGC84177; phosphate cytidylyltransferase 2, ... 43.9 1e-04 mmu:68671 Pcyt2, 1110033E03Rik, ET; phosphate cytidylyltransfe... 43.9 1e-04 dre:450016 pcyt2, im:7158585, wu:fb39h11, zgc:103434; phosphat... 42.4 4e-04 ath:AT2G38670 PECT1; PECT1 (PHOSPHORYLETHANOLAMINE CYTIDYLYLTR... 37.4 0.012 cpv:cgd7_2950 phospholipid cytidyltransferase HIGH family ; K0... 35.8 0.030 cel:Y37E3.11 hypothetical protein; K00967 ethanolamine-phospha... 35.4 0.047 hsa:114826 SMYD4, KIAA1936, ZMYND21; SET and MYND domain conta... 29.6 2.2 xla:398717 invs-b, NPH2, NPHP2; inversin 28.9 4.6 tpv:TP04_0187 ethanolamine-phosphate cytidylyltransferase (EC:... 27.7 9.1 > tgo:TGME49_110280 phosphoethanolamine cytidylyltransferase, putative (EC:4.1.1.70 2.7.7.39 2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=1128 Score = 73.9 bits (180), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/63 (57%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFW-ESLSGQT 68 DPY+VPKE+G+YRE ES S WTTR LV R++ NR+ L ATI R KE FW E GQ Sbjct 1063 DPYRVPKELGVYREVESSSSWTTRALVERILANREALMATIETRCSKEAKFWREQEQGQM 1122 Query 69 ARL 71 L Sbjct 1123 VSL 1125 > pfa:PF13_0253 ethanolamine-phosphate cytidylyltransferase, putative (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=573 Score = 52.4 bits (124), Expect = 4e-07, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 0/54 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWES 63 DPY +PK++ IY+E S S TT E++ R+ +N++ L + R KKE WE+ Sbjct 512 DPYDIPKKLNIYQELSSESNITTYEIIQRIEKNKKYLMRNMSKRNKKEESIWET 565 > hsa:5833 PCYT2, ET; phosphate cytidylyltransferase 2, ethanolamine (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=407 Score = 47.8 bits (112), Expect = 9e-06, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLSGQTA 69 DPY+ PK GI+R+ +S S TT +V R+I NR A +E KE F E+ Q A Sbjct 338 DPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAA 397 Query 70 RLIAE 74 + + E Sbjct 398 QPLGE 402 > xla:444649 pcyt2, MGC84177; phosphate cytidylyltransferase 2, ethanolamine (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=383 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 0/54 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWES 63 DPY PK+ GI+R +S + TT ++V R+I+NR A +E KE +E+ Sbjct 316 DPYAEPKQRGIFRAVDSGNSLTTDDIVQRIIKNRLEYEARNQKKEAKELAVFEA 369 > mmu:68671 Pcyt2, 1110033E03Rik, ET; phosphate cytidylyltransferase 2, ethanolamine (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=404 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 0/60 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLSGQTA 69 DPY+ PK GI+ + +S S TT +V R+I+NR A +E KE F E+ Q A Sbjct 338 DPYQEPKRRGIFYQIDSGSDLTTDLIVQRIIKNRLEYEARNQKKEAKELAFLEATKQQEA 397 > dre:450016 pcyt2, im:7158585, wu:fb39h11, zgc:103434; phosphate cytidylyltransferase 2, ethanolamine (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=397 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 0/65 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLSGQTA 69 DPY PK+ GI+R +S + TT ++V R+I+NR A +E KE ++L + Sbjct 327 DPYAEPKKRGIFRILDSSNNLTTDDIVQRIIENRLQFEARNQKKEAKEMAVLQALKRKDE 386 Query 70 RLIAE 74 + +E Sbjct 387 SVKSE 391 > ath:AT2G38670 PECT1; PECT1 (PHOSPHORYLETHANOLAMINE CYTIDYLYLTRANSFERASE 1); ethanolamine-phosphate cytidylyltransferase (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=421 Score = 37.4 bits (85), Expect = 0.012, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 0/59 (0%) Query 7 QQEDPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESLS 65 ++++PY VP MGI++ +S TT ++ R++ N + +E E ++E S Sbjct 358 EEDNPYSVPISMGIFQVLDSPLDITTSTIIRRIVANHEAYQKRNAKKEASEKKYYEQKS 416 > cpv:cgd7_2950 phospholipid cytidyltransferase HIGH family ; K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=405 Score = 35.8 bits (81), Expect = 0.030, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Query 8 QEDPYKVPKEMGIYREA---ESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWES 63 +E Y++PK+MGI+ + + T R++ SR++ R ++ I R KE F+E+ Sbjct 340 EEFCYEIPKKMGIFCNTTILKKEEICTNRDIFSRIMNRRDSILYVIKKRWAKELSFYEN 398 > cel:Y37E3.11 hypothetical protein; K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=377 Score = 35.4 bits (80), Expect = 0.047, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 0/48 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKE 57 DP+ K GIY E +S S TT ++ R+I +R +EKKE Sbjct 320 DPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKE 367 > hsa:114826 SMYD4, KIAA1936, ZMYND21; SET and MYND domain containing 4 Length=804 Score = 29.6 bits (65), Expect = 2.2, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query 14 VPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWESL 64 V + G R+AESF LW +V + A +G+ +K TH SL Sbjct 677 VQRLSGCQRDAESF-LWAEHAVVGEIADGLARACAALGDWQKSATHLQRSL 726 > xla:398717 invs-b, NPH2, NPHP2; inversin Length=1002 Score = 28.9 bits (63), Expect = 4.6, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 2 GGGFIQQEDPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETH 59 G G + Q + KV +GI + + E SRV + R+T+SA G R ETH Sbjct 819 GCGKLSQSE--KVSLGIGIQGRVDCITSPEPCETPSRVCRERKTISAKTGQRPLTETH 874 > tpv:TP04_0187 ethanolamine-phosphate cytidylyltransferase (EC:2.7.7.14); K00967 ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14] Length=385 Score = 27.7 bits (60), Expect = 9.1, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 0/53 (0%) Query 10 DPYKVPKEMGIYREAESFSLWTTRELVSRVIQNRQTLSATIGNREKKETHFWE 62 +P +V + +GI R +S T+ E++ RV + + +R KKE + ++ Sbjct 330 NPLEVVESLGILRYVDSGLKTTSSEIIKRVSDRMGQIRRNVSDRCKKELNHYK 382 Lambda K H 0.313 0.130 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2002740660 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40