bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1354_orf1 Length=80 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_100100 rhoptry neck protein 2 (EC:3.2.1.39); K14145... 76.6 2e-14 pfa:PF14_0495 PfRON2; rhoptry neck protein 2; K14145 rhoptry n... 36.2 0.030 bbo:BBOV_I001630 19.m02019; hypothetical protein; K14145 rhopt... 35.8 0.033 dre:560283 cax1, MGC136271, si:dkey-180p18.2, wu:fc25f10, zgc:... 29.6 2.7 tgo:TGME49_026870 tubulin gamma chain, putative ; K10389 tubul... 28.5 5.2 > tgo:TGME49_100100 rhoptry neck protein 2 (EC:3.2.1.39); K14145 rhoptry neck protein 2 Length=1404 Score = 76.6 bits (187), Expect = 2e-14, Method: Composition-based stats. Identities = 31/65 (47%), Positives = 45/65 (69%), Gaps = 0/65 (0%) Query 14 LKTLEPFLMASNPLTTGHILTLLIGYIDRDAFFGSSPRKSFYNFTTLVGATGGESGILML 73 L +E F + NP T GH+LTL+I Y+D ++FFG+SP K F+++ +L + G +G ML Sbjct 392 LAAIEIFRLGPNPYTIGHVLTLMIAYLDYESFFGASPSKPFHSWVSLAASAGNNTGFAML 451 Query 74 DEMCD 78 DEMCD Sbjct 452 DEMCD 456 > pfa:PF14_0495 PfRON2; rhoptry neck protein 2; K14145 rhoptry neck protein 2 Length=2189 Score = 36.2 bits (82), Expect = 0.030, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Query 23 ASNPLTTGHILTLLIGYIDRDAFFGSSPRKSFYNFTTLVGATGGESGILMLDEMCD 78 ASN H L L + Y+ + +F ++ KSFY+ T++ A S ML+EMC+ Sbjct 1114 ASNIYLLAHFLVLSLAYLSYNEYF-TTGTKSFYSLPTILTANSDNS-FFMLNEMCN 1167 > bbo:BBOV_I001630 19.m02019; hypothetical protein; K14145 rhoptry neck protein 2 Length=1365 Score = 35.8 bits (81), Expect = 0.033, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Query 24 SNPLTTGHILTLLIGYIDRDAFFGSSPRKSFYNFTTLVGATGGESGIL-MLDEMC 77 +NP GH+ T ++ Y + FF + FY + LV SG L MLD MC Sbjct 366 NNPFLLGHLATNMLAYTQYNMFFAGGSGRPFYTWLDLVS-----SGNLDMLDRMC 415 > dre:560283 cax1, MGC136271, si:dkey-180p18.2, wu:fc25f10, zgc:136271; cation/H+ exchanger protein 1 Length=764 Score = 29.6 bits (65), Expect = 2.7, Method: Composition-based stats. Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Query 9 YSKRKLKTLEPFLMASNPLTTGHILTLLIGYIDRDAFFGSSPRK 52 Y K + + F + PL I+TL+IGY+DR+ +F SS K Sbjct 350 YYKYTVDGINVFAVNLLPLV---IITLIIGYMDRENYFVSSEVK 390 > tgo:TGME49_026870 tubulin gamma chain, putative ; K10389 tubulin gamma Length=455 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query 36 LIGYIDRDAFFGSSPRKSFYNFTTLVGATGGESGILMLDEMCDR 79 L+ IDR+A GS + F ++ G TG G +L+ +CDR Sbjct 120 LLEMIDREAD-GSESLEGFVLCHSIAGGTGSGMGSYLLEALCDR 162 Lambda K H 0.321 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2058492688 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40