bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1579_orf1 Length=134 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 97.8 9e-21 dre:559134 poly(ADP-ribose) glycohydrolase 63 kDa-like; K07759... 30.0 1.8 cel:Y71A12B.15 hypothetical protein 30.0 1.9 sce:YMR308C PSE1, KAP121; Karyopherin/importin that interacts ... 30.0 2.0 bbo:BBOV_III001020 17.m07117; hypothetical protein 29.3 3.9 ath:AT3G07400 lipase class 3 family protein 28.5 5.5 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 97.8 bits (242), Expect = 9e-21, Method: Composition-based stats. Identities = 54/123 (43%), Positives = 76/123 (61%), Gaps = 6/123 (4%) Query 1 LRAAGNYRGGGQLRI-QR-LTTFLAHDRA-FSTTTLPFLASVAMRIQVLFPQGLKHMTRL 57 L+ +GN R RI QR L +L + F + LPF+A++ MRI LFP GL+++T Sbjct 87 LKLSGNIRTEKNKRILQRGLLNYLEENPGKFFSHDLPFMATLVMRIDELFPSGLQYITPE 146 Query 58 RQSTHLRRIQVLCLMAASFFGIIPQNQRKLLRAWGR---LRLNALDMHHRGFLEREPKLK 114 HLR+IQV L+AA+F G+IP NQR LL + + N LDM +RGF+ER+PK + Sbjct 147 NPQVHLRKIQVFTLIAAAFLGVIPHNQRALLAHHQKKFVMNQNKLDMFYRGFMERKPKFQ 206 Query 115 AAL 117 + L Sbjct 207 SVL 209 > dre:559134 poly(ADP-ribose) glycohydrolase 63 kDa-like; K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=777 Score = 30.0 bits (66), Expect = 1.8, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Query 31 TTLPFLASVAMRIQVLFPQGLKHM-TRLRQSTHLRRIQVLCLMAASFFGIIP-QNQRK 86 T LP + + + + Q + + T++ QS + + Q+ CL+A +FF P +N RK Sbjct 387 TILPKMVKLVLNTPKICTQPIPLLKTKMNQSLTMSQEQIACLLANAFFCTFPRRNSRK 444 > cel:Y71A12B.15 hypothetical protein Length=758 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 27/108 (25%), Positives = 42/108 (38%), Gaps = 6/108 (5%) Query 18 LTTFLAHDRAFSTTTLPFLASVAMRIQVLFPQGLKHMTRLRQSTHLRRIQVLCLMAASFF 77 L T R F+ P I+ L ++ L + LR +QVLCL +F Sbjct 164 LRTICLESRKFAANEFPKFCKSFPNIRFLDVSS-TNVRSLDGISKLRNLQVLCLRNLNF- 221 Query 78 GIIPQNQRKLLRAWGRLRLNALDMHHRGFLEREPKLKAALACRGIPPE 125 R ++ +G +LN LD+ ++ LAC + PE Sbjct 222 ----DRYRDMMDLFGLRKLNVLDVSRDWPDNYRQTIRYFLACEKVLPE 265 > sce:YMR308C PSE1, KAP121; Karyopherin/importin that interacts with the nuclear pore complex; acts as the nuclear import receptor for specific proteins, including Pdr1p, Yap1p, Ste12p, and Aft1p Length=1089 Score = 30.0 bits (66), Expect = 2.0, Method: Composition-based stats. Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Query 15 IQRLTTFLAHDRAFST-TTLPFLASVAMR-IQVLFPQGLKHMTRLRQSTHLRRIQVLCLM 72 I+ L TFLA AFS TT+ L++V R + + P K M + TH+R+ +VL + Sbjct 44 IEYLLTFLAEQAAFSQDTTVAALSAVLFRKLALKAPPSSKLMIMSKNITHIRK-EVLAQI 102 Query 73 AASFF 77 +S Sbjct 103 RSSLL 107 > bbo:BBOV_III001020 17.m07117; hypothetical protein Length=837 Score = 29.3 bits (64), Expect = 3.9, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query 102 HHRGFLEREPKLKAAL-ACRGIPPEANS 128 H+ GF + EP L+ AL + RG PPE S Sbjct 517 HYHGFGDNEPPLEFALKSVRGSPPEIKS 544 > ath:AT3G07400 lipase class 3 family protein Length=1003 Score = 28.5 bits (62), Expect = 5.5, Method: Composition-based stats. Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 9/75 (12%) Query 61 THLRRIQVLCLMAASFFGIIPQNQRKLLRAWGRLRL-NALDMHHRGFLEREPKLKAA--- 116 + +RI LC+ FFG+ Q Q L+ W L + ++++ H + P ++ A Sbjct 505 SRFQRIHDLCMDVDGFFGVDQQKQFPHLQQWLGLAVGGSIELGH---IVESPVIRTATSI 561 Query 117 --LACRGIPPEANSK 129 L +G+P + N++ Sbjct 562 APLGWKGVPGDKNAE 576 Lambda K H 0.329 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2231140792 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40