bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1581_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 64.3 1e-10 dre:559995 Unc-93A, unc93a; si:dkey-14a7.1 32.7 0.39 ath:AT2G21720 hypothetical protein 30.0 2.6 mmu:71941 Cars2, 2310051N18Rik, 2410044A07Rik, D530030H10Rik; ... 29.3 4.9 dre:403063 araf, wu:fk45h07, zgc:92074; v-raf murine sarcoma 3... 28.9 5.8 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 64.3 bits (155), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 0/56 (0%) Query 6 FSTTTLPFLASVAMRIQVLFPQGLKHMTRLRQSTHLRRIQVLCLMAASFFGIIPHS 61 F + LPF+A++ MRI LFP GL+++T HLR+IQV L+AA+F G+IPH+ Sbjct 117 FFSHDLPFMATLVMRIDELFPSGLQYITPENPQVHLRKIQVFTLIAAAFLGVIPHN 172 > dre:559995 Unc-93A, unc93a; si:dkey-14a7.1 Length=465 Score = 32.7 bits (73), Expect = 0.39, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 7/57 (12%) Query 36 RQSTHLRRIQVLCLMAA----SFFGII---PHSSSFSWFVIMSVLAKFVDASWAPQT 85 R + + RI + CL AA SF G++ PH + F + L DA W QT Sbjct 311 RLAQYTGRIALFCLAAAINLGSFLGLLYWKPHPDQLAIFFVFPALWGMADAVWQTQT 367 > ath:AT2G21720 hypothetical protein Length=734 Score = 30.0 bits (66), Expect = 2.6, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query 29 LKHMTRLRQSTHLRRIQVLCLMAASFFGIIPHSSSFSWFVIMSVLAKFVDAS 80 L+ + + S H + L L+ ASFF ++P F F+I ++ FV S Sbjct 652 LRSLYTSKASKHASMVMALMLVLASFFAVVP----FKLFIIFGIVYCFVMTS 699 > mmu:71941 Cars2, 2310051N18Rik, 2410044A07Rik, D530030H10Rik; cysteinyl-tRNA synthetase 2 (mitochondrial)(putative) (EC:6.1.1.16); K01883 cysteinyl-tRNA synthetase [EC:6.1.1.16] Length=552 Score = 29.3 bits (64), Expect = 4.9, Method: Compositional matrix adjust. Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 6/104 (5%) Query 4 RAFSTTTLPFLASVAMRIQVLFPQGLKHMTRLRQSTHLRRIQVLCLMAASFFGIIPHSSS 63 RA P AS+A + F Q + + L + +LR + + + A GII H + Sbjct 113 RANEMNVTP--ASLASLFEEEFKQDMAALKVLPPTVYLRVTENIPQIIAFIEGIIAHGHA 170 Query 64 FSWFVIMSVLAKFVDASWAPQTPSASIEEVPSAVLWPAGESHQR 107 +S + + + D + VPSA PAG+S +R Sbjct 171 YS----TATGSVYFDLHARGDKYGKLVNTVPSATAEPAGDSDKR 210 > dre:403063 araf, wu:fk45h07, zgc:92074; v-raf murine sarcoma 3611 viral oncogene homolog; K08845 A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1] Length=608 Score = 28.9 bits (63), Expect = 5.8, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 91 EEVPSAVLWPAGESHQRRIQKILSGIEGGDIPSSASEF 128 E+ P+ +++PA S + + S GG++PSS S F Sbjct 163 EDCPAILIYPATNSISQSDLPLTSDSPGGELPSSPSNF 200 Lambda K H 0.324 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3003468616 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40