bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1585_orf1 Length=160 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 70.9 2e-12 dre:559134 poly(ADP-ribose) glycohydrolase 63 kDa-like; K07759... 30.0 3.1 ath:AT5G64820 hypothetical protein 30.0 3.4 dre:403063 araf, wu:fk45h07, zgc:92074; v-raf murine sarcoma 3... 28.9 6.8 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 70.9 bits (172), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 0/61 (0%) Query 6 FSTTTLPFLASVAMRIQVLFPQGLKHMTRLRQSTHLRRIQVLCLMAASFFGIIPQNQRKL 65 F + LPF+A++ MRI LFP GL+++T HLR+IQV L+AA+F G+IP NQR L Sbjct 117 FFSHDLPFMATLVMRIDELFPSGLQYITPENPQVHLRKIQVFTLIAAAFLGVIPHNQRAL 176 Query 66 L 66 L Sbjct 177 L 177 > dre:559134 poly(ADP-ribose) glycohydrolase 63 kDa-like; K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=777 Score = 30.0 bits (66), Expect = 3.1, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Query 9 TTLPFLASVAMRIQVLFPQGLKHM-TRLRQSTHLRRIQVLCLMAASFFGIIP-QNQRK 64 T LP + + + + Q + + T++ QS + + Q+ CL+A +FF P +N RK Sbjct 387 TILPKMVKLVLNTPKICTQPIPLLKTKMNQSLTMSQEQIACLLANAFFCTFPRRNSRK 444 > ath:AT5G64820 hypothetical protein Length=145 Score = 30.0 bits (66), Expect = 3.4, Method: Compositional matrix adjust. Identities = 23/67 (34%), Positives = 29/67 (43%), Gaps = 13/67 (19%) Query 71 RLRLSFSWFVIMSVLAKFVDASWAPQTPSASIEEVPSAVLWPAGESHQRRIQKILSGIEG 130 R+R S F I+ +L V A A +A EE PS V KI+SGI G Sbjct 6 RIRFGVSVFCIIIILISGVSADGAESDSAAKKEENPSIV-------------KIISGIFG 52 Query 131 GDIPSSA 137 P S+ Sbjct 53 NKFPPSS 59 > dre:403063 araf, wu:fk45h07, zgc:92074; v-raf murine sarcoma 3611 viral oncogene homolog; K08845 A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1] Length=608 Score = 28.9 bits (63), Expect = 6.8, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 0/38 (0%) Query 103 EEVPSAVLWPAGESHQRRIQKILSGIEGGDIPSSASEF 140 E+ P+ +++PA S + + S GG++PSS S F Sbjct 163 EDCPAILIYPATNSISQSDLPLTSDSPGGELPSSPSNF 200 Lambda K H 0.325 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3712313100 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40