bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1637_orf2 Length=140 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_120640 cyclophilin, putative (EC:5.2.1.8); K12736 p... 64.3 1e-10 ath:AT3G44600 CYP71; CYP71 (CYCLOPHILIN71); chromatin binding ... 46.6 3e-05 > tgo:TGME49_120640 cyclophilin, putative (EC:5.2.1.8); K12736 peptidylprolyl isomerase domain and WD repeat-containing protein 1 [EC:5.2.1.8] Length=764 Score = 64.3 bits (155), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 32/66 (48%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Query 1 VSNFDMACLVSLDFIPWACEFVSKKGDATPLVAVSDKESPTVVVLKPLLHGAKPVVSFSL 60 V FDM CL+ L F P ACEFV + + P+VA+S KE+P + + KP L ++ V SFSL Sbjct 267 VVTFDMLCLLKLPFEPLACEFVHGREEPAPVVAISAKETPEIFLYKPTL-SSESVGSFSL 325 Query 61 HQDEAH 66 H AH Sbjct 326 HMAPAH 331 > ath:AT3G44600 CYP71; CYP71 (CYCLOPHILIN71); chromatin binding / histone binding / peptidyl-prolyl cis-trans isomerase; K12736 peptidylprolyl isomerase domain and WD repeat-containing protein 1 [EC:5.2.1.8] Length=631 Score = 46.6 bits (109), Expect = 3e-05, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 0/63 (0%) Query 1 VSNFDMACLVSLDFIPWACEFVSKKGDATPLVAVSDKESPTVVVLKPLLHGAKPVVSFSL 60 V N+DM ++ L +IP A E+V K+GD +AVSD++S V + P +P+ S + Sbjct 142 VVNYDMMAMIRLPYIPGAVEWVYKQGDVKAKLAVSDRDSLFVHIYDPRSGSNEPIASKEI 201 Query 61 HQD 63 H + Sbjct 202 HMN 204 Lambda K H 0.306 0.117 0.335 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2552834388 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40