bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1642_orf1 Length=82 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_119530 splicing factor, putative 67.4 1e-11 dre:405835 MGC77449; zgc:77449; K12890 splicing factor, argini... 62.0 4e-10 mmu:108014 Srsf9, 25kDa, 2610029M16Rik, SRp30c, Sfrs9; serine/... 60.1 2e-09 hsa:8683 SRSF9, SFRS9, SRp30c; serine/arginine-rich splicing f... 60.1 2e-09 dre:406288 srsf1a, sfrs1a, sfrs1l, wu:fb52g10, wu:fb97g12, zgc... 56.2 2e-08 dre:393565 srsf1b, MGC65898, sfrs1, sfrs1b, wu:fb80g05, zgc:11... 56.2 3e-08 xla:495254 srsf9, sfrs9, srp30c; serine/arginine-rich splicing... 55.8 3e-08 mmu:110809 Srsf1, 1110054N12Rik, 5730507C05Rik, 6330415C05Rik,... 55.5 4e-08 hsa:6426 SRSF1, ASF, FLJ53078, MGC5228, SF2, SF2p33, SFRS1, SR... 55.5 4e-08 cel:Y111B2A.18 rsp-3; SR Protein (splicing factor) family memb... 55.1 6e-08 cel:F29C4.7 hypothetical protein 50.4 1e-06 tpv:TP04_0313 splicing factor; K12890 splicing factor, arginin... 50.4 1e-06 ath:AT3G49430 SRp34a; SRp34a (Ser/Arg-rich protein 34a); RNA b... 50.4 1e-06 ath:AT1G02840 SR1; SR1; RNA binding / nucleic acid binding / n... 48.9 4e-06 ath:AT1G09140 SF2/ASF-like splicing modulator (SRP30); K12890 ... 48.1 6e-06 tpv:TP01_0865 hypothetical protein 47.4 1e-05 ath:AT4G02430 pre-mRNA splicing factor, putative / SR1 protein... 47.0 1e-05 dre:556409 g3bp2, wu:fb43h08, wu:fc13c01, wu:fe25b02, zgc:1583... 46.6 2e-05 dre:100334657 Ras-GTPase activating protein SH3 domain-binding... 46.6 2e-05 cel:C33H5.12 rsp-6; SR Protein (splicing factor) family member... 46.2 2e-05 pfa:PFE0865c splicing factor, putative 46.2 3e-05 pfa:PF11_0205 alternative splicing factor ASF-1 46.2 3e-05 pfa:PF10_0217 pre-mRNA splicing factor, putative 45.8 4e-05 dre:100333198 Ras-GTPase activating protein SH3 domain-binding... 44.7 7e-05 bbo:BBOV_II002700 18.m06220; splicing factor, arginine/serine-... 44.3 1e-04 dre:406683 wu:fj98c08, zgc:111883, zgc:77426; zgc:56304 43.9 1e-04 tpv:TP02_0374 spliceosome associated protein; K12831 splicing ... 43.5 1e-04 xla:380427 nono, MGC53535, nmt55, nrb54, p54nrb; non-POU domai... 43.5 2e-04 dre:550495 wu:fb12a12, wu:fb16h02, wu:fb55a06, wu:fc67h01, wu:... 43.5 2e-04 bbo:BBOV_II005820 18.m06483; pre-mRNA branch site protein p14;... 43.1 2e-04 hsa:9908 G3BP2; GTPase activating protein (SH3 domain) binding... 43.1 2e-04 xla:447602 MGC84815 protein 43.1 2e-04 mmu:23881 G3bp2, AA409541, E430034L04Rik, G3BP, KIAA0660, mKIA... 43.1 2e-04 ath:AT5G12190 RNA recognition motif (RRM)-containing protein; ... 42.7 3e-04 ath:AT1G23860 RSZP21; RSZP21 (RS-CONTAINING ZINC FINGER PROTEI... 42.7 3e-04 ath:AT3G13224 RNA recognition motif (RRM)-containing protein 42.7 3e-04 ath:AT4G03110 RNA-binding protein, putative 42.7 3e-04 cel:C50D2.5 hypothetical protein; K12833 pre-mRNA branch site ... 42.7 3e-04 cpv:cgd7_1620 nop15p/nopp34; nucleolar protein with 1 RRM doma... 42.4 3e-04 xla:446341 g3bp2, MGC81268; GTPase activating protein (SH3 dom... 42.4 4e-04 cel:ZC404.8 spn-4; SPiNdle orientation defective family member... 42.4 4e-04 xla:494769 rbm19; RNA binding motif protein 19; K14787 multipl... 42.0 4e-04 dre:335512 g3bp1, fj17h05, wu:fj17h05, zgc:56034; GTPase activ... 42.0 4e-04 mmu:27041 G3bp1, AI849976, B430204O07, C87777, G3bp, KIAA4115,... 42.0 5e-04 tpv:TP01_1032 hypothetical protein; K14838 nucleolar protein 15 42.0 mmu:545592 Gm11847, OTTMUSG00000004599; heterogeneous nuclear ... 41.6 5e-04 dre:415157 sf3b14, zgc:86708; splicing factor 3B; K12833 pre-m... 41.6 6e-04 mmu:66055 0610009D07Rik, 6030419K15Rik, AV001342, Sf3b14; RIKE... 41.6 6e-04 hsa:51639 SF3B14, HSPC175, Ht006, P14, SAP14, SF3B14a; splicin... 41.6 6e-04 tpv:TP03_0226 splicing factor 41.6 6e-04 > tgo:TGME49_119530 splicing factor, putative Length=512 Score = 67.4 bits (163), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 30/46 (65%), Positives = 38/46 (82%), Gaps = 0/46 (0%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVF 78 R++V NLP DVTE E++DLFYKFGRI DIE++R R ND++ AFV F Sbjct 21 RIFVANLPLDVTENELEDLFYKFGRIEDIEMRRDRTNDSTIAFVQF 66 Score = 36.6 bits (83), Expect = 0.022, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 0/32 (0%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAIE 32 I DIE++R R ND++ AFV F + + DDAIE Sbjct 46 IEDIEMRRDRTNDSTIAFVQFAEYKAADDAIE 77 > dre:405835 MGC77449; zgc:77449; K12890 splicing factor, arginine/serine-rich 1/9 Length=244 Score = 62.0 bits (149), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP DV ER+++DLF+K+G+IRDIE+K +R FAFV F+D Sbjct 5 RIYVGNLPMDVQERDIEDLFFKYGKIRDIELKNNRST-IPFAFVRFEDP 52 Score = 28.9 bits (63), Expect = 4.4, Method: Compositional matrix adjust. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IRDIE+K +R FAFV F+D +DA+ Sbjct 30 IRDIELKNNRST-IPFAFVRFEDPRDAEDAV 59 > mmu:108014 Srsf9, 25kDa, 2610029M16Rik, SRp30c, Sfrs9; serine/arginine-rich splicing factor 9; K12890 splicing factor, arginine/serine-rich 1/9 Length=222 Score = 60.1 bits (144), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP DV E++++DLFYK+GRIR+IE+K +R FAFV F+D Sbjct 16 RIYVGNLPSDVREKDLEDLFYKYGRIREIELK-NRHGLVPFAFVRFEDP 63 > hsa:8683 SRSF9, SFRS9, SRp30c; serine/arginine-rich splicing factor 9; K12890 splicing factor, arginine/serine-rich 1/9 Length=221 Score = 60.1 bits (144), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP DV E++++DLFYK+GRIR+IE+K +R FAFV F+D Sbjct 15 RIYVGNLPTDVREKDLEDLFYKYGRIREIELK-NRHGLVPFAFVRFEDP 62 > dre:406288 srsf1a, sfrs1a, sfrs1l, wu:fb52g10, wu:fb97g12, zgc:66146; serine/arginine-rich splicing factor 1a; K12890 splicing factor, arginine/serine-rich 1/9 Length=245 Score = 56.2 bits (134), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 26/49 (53%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP D+ ++V+D+FYK+G IRDI++K +R+ FAFV F+D Sbjct 16 RIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLK-NRRGGPPFAFVEFEDP 63 Score = 28.5 bits (62), Expect = 6.2, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IRDI++K +R+ FAFV F+D +DA+ Sbjct 41 IRDIDLK-NRRGGPPFAFVEFEDPRDAEDAV 70 > dre:393565 srsf1b, MGC65898, sfrs1, sfrs1b, wu:fb80g05, zgc:111894, zgc:65898, zgc:76897; serine/arginine-rich splicing factor 1b; K12890 splicing factor, arginine/serine-rich 1/9 Length=245 Score = 56.2 bits (134), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 26/49 (53%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP D+ ++V+D+FYK+G IRDI++K +R+ FAFV F+D Sbjct 16 RIYVGNLPPDIRTKDVEDVFYKYGAIRDIDLK-NRRGGPPFAFVEFEDP 63 Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IRDI++K +R+ FAFV F+D +DA+ Sbjct 41 IRDIDLK-NRRGGPPFAFVEFEDPRDAEDAV 70 > xla:495254 srsf9, sfrs9, srp30c; serine/arginine-rich splicing factor 9; K12890 splicing factor, arginine/serine-rich 1/9 Length=230 Score = 55.8 bits (133), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 23/49 (46%), Positives = 35/49 (71%), Gaps = 0/49 (0%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP D+ E+E++DLF ++GRIR +E+K + FAF+ + D Sbjct 17 RIYVGNLPSDIREKELEDLFDRYGRIRTVELKNRGGSSAPFAFISYQDP 65 > mmu:110809 Srsf1, 1110054N12Rik, 5730507C05Rik, 6330415C05Rik, AI482334, AW491331, Asf, Sf2, Sfrs1; serine/arginine-rich splicing factor 1; K12890 splicing factor, arginine/serine-rich 1/9 Length=201 Score = 55.5 bits (132), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP D+ ++++D+FYK+G IRDI++K +R+ FAFV F+D Sbjct 17 RIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLK-NRRGGPPFAFVEFEDP 64 Score = 28.1 bits (61), Expect = 6.5, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IRDI++K +R+ FAFV F+D +DA+ Sbjct 42 IRDIDLK-NRRGGPPFAFVEFEDPRDAEDAV 71 > hsa:6426 SRSF1, ASF, FLJ53078, MGC5228, SF2, SF2p33, SFRS1, SRp30a; serine/arginine-rich splicing factor 1; K12890 splicing factor, arginine/serine-rich 1/9 Length=201 Score = 55.5 bits (132), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 R+YVGNLP D+ ++++D+FYK+G IRDI++K +R+ FAFV F+D Sbjct 17 RIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLK-NRRGGPPFAFVEFEDP 64 Score = 28.1 bits (61), Expect = 6.7, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAI 31 IRDI++K +R+ FAFV F+D +DA+ Sbjct 42 IRDIDLK-NRRGGPPFAFVEFEDPRDAEDAV 71 > cel:Y111B2A.18 rsp-3; SR Protein (splicing factor) family member (rsp-3); K12890 splicing factor, arginine/serine-rich 1/9 Length=258 Score = 55.1 bits (131), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 25/49 (51%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +++YVGNLP DV E+EV+D+F+K+GRI+ +++K R +FAFV F+D Sbjct 9 QKVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRG--PAFAFVEFED 55 > cel:F29C4.7 hypothetical protein Length=497 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 35/52 (67%), Gaps = 0/52 (0%) Query 28 DDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 D+A L+VGN+P DV ERE+ +F + G++ ++++K D ++AFV+F Sbjct 142 DEATRTLFVGNMPSDVKEREIRHVFEEHGKVEEVDIKTPINTDAAYAFVMFQ 193 > tpv:TP04_0313 splicing factor; K12890 splicing factor, arginine/serine-rich 1/9 Length=257 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query 29 DAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 D + R+Y+GNLP D ++RE+++ F KFGRI E+K+S + + FAF+ F D Sbjct 4 DDLSRIYIGNLPEDCSQRELEEEFEKFGRIIYCELKKS-YSGSPFAFIEFSD 54 > ath:AT3G49430 SRp34a; SRp34a (Ser/Arg-rich protein 34a); RNA binding / nucleic acid binding / nucleotide binding Length=297 Score = 50.4 bits (119), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 23/46 (50%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 +YVGNLP D+ E E++D+FYK+GRI DIE+K + + FV F+ Sbjct 9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPR-PPCYCFVEFE 53 > ath:AT1G02840 SR1; SR1; RNA binding / nucleic acid binding / nucleotide binding; K12890 splicing factor, arginine/serine-rich 1/9 Length=303 Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +YVGNLP D+ EREV+DLF K+G + I++K + +AFV FDD Sbjct 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRP-PGYAFVEFDD 54 > ath:AT1G09140 SF2/ASF-like splicing modulator (SRP30); K12890 splicing factor, arginine/serine-rich 1/9 Length=268 Score = 48.1 bits (113), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 24/48 (50%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 +YVGNLP D+ + EV+DLFYK+G I DI++K + +AFV F+D Sbjct 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRP-PGYAFVEFEDP 55 > tpv:TP01_0865 hypothetical protein Length=343 Score = 47.4 bits (111), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 24/46 (52%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSR-KNDTSFAFVVF 78 ++VGNLP V ER++ DLF KFG I+DI++K + N TS+AF+ F Sbjct 15 VFVGNLPDRVDERDIQDLFDKFGEIKDIDIKHGKTSNYTSYAFIEF 60 > ath:AT4G02430 pre-mRNA splicing factor, putative / SR1 protein, putative Length=278 Score = 47.0 bits (110), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +YVGNLP D+ EREV+DLF K+G + I++K + +AFV F+D Sbjct 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRP-PGYAFVEFED 54 > dre:556409 g3bp2, wu:fb43h08, wu:fc13c01, wu:fe25b02, zgc:158370; GTPase activating protein (SH3 domain) binding protein 2 Length=507 Score = 46.6 bits (109), Expect = 2e-05, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEV--KRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ D F FG + ++ + K + +F FVVFDD Sbjct 354 QLFVGNLPHDIDESELKDFFMTFGNVVELRINTKSTGGKIPNFGFVVFDD 403 > dre:100334657 Ras-GTPase activating protein SH3 domain-binding protein 2-like Length=507 Score = 46.6 bits (109), Expect = 2e-05, Method: Composition-based stats. Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEV--KRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ D F FG + ++ + K + +F FVVFDD Sbjct 354 QLFVGNLPHDIDESELKDFFMTFGNVVELRINTKSTGGKIPNFGFVVFDD 403 > cel:C33H5.12 rsp-6; SR Protein (splicing factor) family member (rsp-6); K12896 splicing factor, arginine/serine-rich 7 Length=179 Score = 46.2 bits (108), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 ++YVG LP D T +E++++F +FGRIR + V R FAFV +DD Sbjct 4 KVYVGGLPSDATSQELEEIFDRFGRIRKVWVAR---RPPGFAFVEYDD 48 > pfa:PFE0865c splicing factor, putative Length=298 Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Query 27 VDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 + +++ R+YVGNLP V+ R+V++ F K+G I +VK++ + +FAF+ F+D Sbjct 3 IRESVSRIYVGNLPSHVSSRDVENEFRKYGNILKCDVKKT-VSGAAFAFIEFED 55 > pfa:PF11_0205 alternative splicing factor ASF-1 Length=200 Score = 46.2 bits (108), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRK-NDTSFAFVVFDD 80 RLYVGN+P T +E+ +F ++G+I DI++K +R N T++AF+ +++ Sbjct 10 RLYVGNIPGSATRQELIKIFEEYGKISDIDIKYNRNSNGTNYAFIEYEN 58 > pfa:PF10_0217 pre-mRNA splicing factor, putative Length=538 Score = 45.8 bits (107), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/45 (55%), Positives = 35/45 (77%), Gaps = 0/45 (0%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVF 78 +YVGNLP +V E EV DLF K+GRI+ I++K SR + +S+AFV + Sbjct 14 IYVGNLPGNVIEEEVYDLFGKYGRIKYIDIKPSRSSSSSYAFVHY 58 > dre:100333198 Ras-GTPase activating protein SH3 domain-binding protein 2-like Length=690 Score = 44.7 bits (104), Expect = 7e-05, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRD--IEVKRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ D F FG + + I K +F FVVFDD Sbjct 553 QLFVGNLPHDIDEGELKDFFMTFGNVVEMRINTKGVGGKLPNFGFVVFDD 602 > bbo:BBOV_II002700 18.m06220; splicing factor, arginine/serine-rich 3; K12890 splicing factor, arginine/serine-rich 1/9 Length=239 Score = 44.3 bits (103), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Query 26 SVDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 S ++ R+YVGNLP T+++++D F KFG++ ++K++ T FAF+ ++D Sbjct 2 SREEESARVYVGNLPESCTQKDIEDEFGKFGKLISCDLKKNAGGST-FAFLEYED 55 > dre:406683 wu:fj98c08, zgc:111883, zgc:77426; zgc:56304 Length=461 Score = 43.9 bits (102), Expect = 1e-04, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRD--IEVKRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ D F FG + + I K +F FVVFDD Sbjct 364 QLFVGNLPHDIDEGELKDFFMTFGNVVEMRINTKGVGGKLPNFGFVVFDD 413 > tpv:TP02_0374 spliceosome associated protein; K12831 splicing factor 3B subunit 4 Length=290 Score = 43.5 bits (101), Expect = 1e-04, Method: Composition-based stats. Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 0/48 (0%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +L+VGNL +V ER + D F FGR+ ++ RS + ++A V FDD Sbjct 106 KLFVGNLDDEVDERLLHDTFSAFGRVLSAKMVRSETSGKTYAIVSFDD 153 Score = 30.0 bits (66), Expect = 2.0, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSR--KNDTSFAFVVFD 79 LY+GNL E + + F + GR++ I V R + F FV ++ Sbjct 20 LYIGNLDLQADEELLWEFFMQAGRVKSINVPRDKVTGQHQGFGFVEYE 67 > xla:380427 nono, MGC53535, nmt55, nrb54, p54nrb; non-POU domain containing, octamer-binding; K13214 non-POU domain-containing octamer-binding protein Length=464 Score = 43.5 bits (101), Expect = 2e-04, Method: Composition-based stats. Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 RL+VGNLP DVTE E+ LF KFG+ +I + + D F F+ + + Sbjct 69 RLFVGNLPSDVTEEEMRKLFEKFGKAGEIFIHK----DKGFGFIRLETR 113 > dre:550495 wu:fb12a12, wu:fb16h02, wu:fb55a06, wu:fc67h01, wu:fj10g10, zgc:109887; zgc:112425; K13195 cold-inducible RNA-binding protein Length=185 Score = 43.5 bits (101), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDD 80 +L++G L +D TE+ ++D F K+G I ++ V R+R+ + S F FV F++ Sbjct 6 KLFIGGLSFDTTEQSLEDAFSKYGVITNVHVARNRETNRSRGFGFVTFEN 55 > bbo:BBOV_II005820 18.m06483; pre-mRNA branch site protein p14; K12833 pre-mRNA branch site protein p14 Length=122 Score = 43.1 bits (100), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDKY 82 LY+ NLPY ++ E+ D+F K+G +R I + K + + AFVV+DD Y Sbjct 22 LYLRNLPYKISAEELYDIFGKYGSVRQIRKGNTSKTNGT-AFVVYDDIY 69 > hsa:9908 G3BP2; GTPase activating protein (SH3 domain) binding protein 2 Length=482 Score = 43.1 bits (100), Expect = 2e-04, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEV--KRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ + F FG + ++ + K +F FVVFDD Sbjct 332 QLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDD 381 > xla:447602 MGC84815 protein Length=291 Score = 43.1 bits (100), Expect = 2e-04, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Query 27 VDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDD 80 V A+++++VG L DVT ++ + F KFG + D + ++ +TS FAFV FDD Sbjct 98 VHAAVKKIFVGGLKKDVTNEDLAEYFGKFGNVTDASIVVAKDTNTSRGFAFVTFDD 153 > mmu:23881 G3bp2, AA409541, E430034L04Rik, G3BP, KIAA0660, mKIAA0660; GTPase activating protein (SH3 domain) binding protein 2 Length=482 Score = 43.1 bits (100), Expect = 2e-04, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEV--KRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ + F FG + ++ + K +F FVVFDD Sbjct 332 QLFVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDD 381 > ath:AT5G12190 RNA recognition motif (RRM)-containing protein; K12833 pre-mRNA branch site protein p14 Length=124 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDKY 82 LYV NLP+++T E+ D+F K+G IR I + + + AFVV++D Y Sbjct 21 LYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATKGT-AFVVYEDIY 68 > ath:AT1G23860 RSZP21; RSZP21 (RS-CONTAINING ZINC FINGER PROTEIN 21); protein binding Length=164 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 3/51 (5%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 + R+YVGNL VTERE++D F FG +R++ V R +AF+ FDD+ Sbjct 1 MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVAR---RPPGYAFLEFDDE 48 > ath:AT3G13224 RNA recognition motif (RRM)-containing protein Length=358 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 17/86 (19%) Query 2 RDIEVKRSRKNDTSFAFVVFDDKYSVDDAIERLYVGNLPYDVTEREVDDLFYKFGR---- 57 + +E+KR+ S D ++++VG +P VTE E+ D F K+G Sbjct 86 KQVEIKRTIPKGAG-------GNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVEH 138 Query 58 --IRDIEVKRSRKNDTSFAFVVFDDK 81 IRD E RSR F FV+FD + Sbjct 139 QVIRDHETNRSR----GFGFVIFDSE 160 Score = 28.1 bits (61), Expect = 6.9, Method: Compositional matrix adjust. Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 16/66 (24%) Query 1 IRDIEVKRSRKNDTSFAFVVFDDKYSVDDAIERLYVGNLPYDVTEREVDDLFYKFGRIRD 60 IRD E RSR F FV+FD + VD E L GN+ D+ + +V+ I+ Sbjct 141 IRDHETNRSR----GFGFVIFDSEEVVD---ELLSKGNM-IDMADTQVE--------IKK 184 Query 61 IEVKRS 66 E K+S Sbjct 185 AEPKKS 190 Score = 28.1 bits (61), Expect = 7.8, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDT--SFAFVVFDDK 81 ++++G L D T + F K+G I D + R R F F+ F D Sbjct 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADP 70 > ath:AT4G03110 RNA-binding protein, putative Length=441 Score = 42.7 bits (99), Expect = 3e-04, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Query 24 KYSVDDAIERL----YVGNLPYDVTEREVDDLFYKFGRIRDIEVKR-SRKNDTSFAFVVF 78 KY+ D +ERL +VG LP +V+E EV LF K+G I+D+++ R +++ AF+ + Sbjct 95 KYA-DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKY 153 Query 79 DDK 81 + K Sbjct 154 ETK 156 > cel:C50D2.5 hypothetical protein; K12833 pre-mRNA branch site protein p14 Length=138 Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LY+ NLPY +T E+ ++F KFG +R I V + + + AFVV++D Sbjct 21 LYIKNLPYKITTEEMYEIFGKFGAVRQIRVGNTAETRGT-AFVVYED 66 > cpv:cgd7_1620 nop15p/nopp34; nucleolar protein with 1 RRM domain ; K14838 nucleolar protein 15 Length=156 Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDD 80 +YVG++P+ + E ++ + F +FG+I I++ RS+KN S +AF+ F+ Sbjct 18 VYVGHIPFGLFEPQLKEYFSQFGKILRIKLSRSKKNGHSRGYAFIEFES 66 > xla:446341 g3bp2, MGC81268; GTPase activating protein (SH3 domain) binding protein 2 Length=483 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEV--KRSRKNDTSFAFVVFDD 80 +L+VGNLP+D+ E E+ + F +G + ++ + K +F FVVFDD Sbjct 333 QLFVGNLPHDIDESELKEFFMSYGNVMELRINTKGVGGKLPNFGFVVFDD 382 > cel:ZC404.8 spn-4; SPiNdle orientation defective family member (spn-4); K14946 RNA binding protein fox-1 Length=351 Score = 42.4 bits (98), Expect = 4e-04, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 0/47 (0%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFD 79 R+YV N+P+ E+++ +F+ +GR+ +E+ + + F FV D Sbjct 52 RIYVSNIPFSFREQDLAAMFFAYGRVLSVEIVTNDRGSKGFGFVTLD 98 > xla:494769 rbm19; RNA binding motif protein 19; K14787 multiple RNA-binding domain-containing protein 1 Length=920 Score = 42.0 bits (97), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIE--VKRSRKNDTSFAFVVF 78 RL+V NLPY TE ++D LF K+G I +I + K FAFV F Sbjct 387 RLFVRNLPYSCTEDDLDKLFSKYGPISEIHFPIDSLTKKPKGFAFVTF 434 Score = 31.6 bits (70), Expect = 0.64, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS---FAFVVF 78 ++ V N+P+ T RE+ +LF FG ++ + + + S F FV F Sbjct 798 KILVRNVPFQATVREIRELFSTFGELKTVRLPKKMAGTGSHRGFGFVDF 846 Score = 29.3 bits (64), Expect = 3.5, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKND-TSFAFVVF 78 + RL V NLP + E +LF FG + D +K ++ F F+ F Sbjct 1 MSRLIVKNLPNGIKEDRFRELFAAFGTLTDCSLKYTKDGKFRKFGFIGF 49 > dre:335512 g3bp1, fj17h05, wu:fj17h05, zgc:56034; GTPase activating protein (SH3 domain) binding protein 1 Length=477 Score = 42.0 bits (97), Expect = 4e-04, Method: Composition-based stats. Identities = 18/48 (37%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +L+VGN+P+DV + E+ + F ++G + ++ + K +F FVVFDD Sbjct 344 QLFVGNVPHDVDKNELKEFFEQYGTVLELRINSGGKL-PNFGFVVFDD 390 > mmu:27041 G3bp1, AI849976, B430204O07, C87777, G3bp, KIAA4115, mKIAA4115; Ras-GTPase-activating protein SH3-domain binding protein 1 (EC:3.6.4.13 3.6.4.12) Length=465 Score = 42.0 bits (97), Expect = 5e-04, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Query 33 RLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 +L++GNLP++V + E+ D F FG + ++ + K +F FVVFDD Sbjct 339 QLFIGNLPHEVDKSELKDFFQNFGNVVELRINSGGKL-PNFGFVVFDD 385 > tpv:TP01_1032 hypothetical protein; K14838 nucleolar protein 15 Length=195 Score = 42.0 bits (97), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTS--FAFVVFDD 80 +YVGNLP +TE ++ F +FG + I + +SRK + S +AFV F+D Sbjct 15 IYVGNLPKQLTEEQLKTYFNQFGDVIKIRLFKSRKTNRSRGYAFVQFED 63 > mmu:545592 Gm11847, OTTMUSG00000004599; heterogeneous nuclear ribonucleoprotein A3 pseudogene; K12741 heterogeneous nuclear ribonucleoprotein A1/A3 Length=362 Score = 41.6 bits (96), Expect = 5e-04, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Query 31 IERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKN--DTSFAFVVFDD 80 +++++VG + D E + D F K+G+I IEV R++ FAFV FDD Sbjct 125 VKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDD 176 Score = 29.6 bits (65), Expect = 2.8, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 10/56 (17%) Query 29 DAIERLYVGNLPYDVTEREVDDLFYKFGRI------RDIEVKRSRKNDTSFAFVVF 78 + + +L++G L ++ T+ + + F K+G + RD + KRSR F FV + Sbjct 32 EQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSR----GFGFVTY 83 > dre:415157 sf3b14, zgc:86708; splicing factor 3B; K12833 pre-mRNA branch site protein p14 Length=125 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LY+ NLPY +T E+ D+F K+G IR I V + + + A+VV++D Sbjct 21 LYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGT-AYVVYED 66 > mmu:66055 0610009D07Rik, 6030419K15Rik, AV001342, Sf3b14; RIKEN cDNA 0610009D07 gene; K12833 pre-mRNA branch site protein p14 Length=125 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LY+ NLPY +T E+ D+F K+G IR I V + + + A+VV++D Sbjct 21 LYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGT-AYVVYED 66 > hsa:51639 SF3B14, HSPC175, Ht006, P14, SAP14, SF3B14a; splicing factor 3B, 14 kDa subunit; K12833 pre-mRNA branch site protein p14 Length=125 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query 34 LYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDD 80 LY+ NLPY +T E+ D+F K+G IR I V + + + A+VV++D Sbjct 21 LYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGT-AYVVYED 66 > tpv:TP03_0226 splicing factor Length=132 Score = 41.6 bits (96), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query 32 ERLYVGNLPYDVTEREVDDLFYKFGRIRDIEVKRSRKNDTSFAFVVFDDK 81 +L+VGNL VT +++D LF K+G++ ++ V R N F FV FDD Sbjct 11 HKLFVGNLVDSVTSQDLDLLFSKYGKVTNVWVAR---NPPGFGFVTFDDP 57 Lambda K H 0.324 0.143 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2049280912 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40