bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_1678_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_079430 hypothetical protein ; K12871 coiled-coil do... 127 9e-30 pfa:PF14_0490 conserved Plasmodium protein, unknown function; ... 77.0 1e-14 tpv:TP01_0018 hypothetical protein; K12871 coiled-coil domain-... 75.1 5e-14 mmu:72654 Ccdc12, 2700094L05Rik, C76605; coiled-coil domain co... 68.9 4e-12 dre:793027 ccdc12, MGC101038, zgc:101038; coiled-coil domain c... 67.8 7e-12 hsa:151903 CCDC12, FLJ39430, FLJ40801, MGC23918; coiled-coil d... 67.8 9e-12 ath:AT3G05070 hypothetical protein; K12871 coiled-coil domain-... 66.6 2e-11 xla:100037064 hypothetical protein LOC100037064; K12871 coiled... 66.2 3e-11 xla:100037234 ccdc12; coiled-coil domain containing 12 65.1 bbo:BBOV_I002710 19.m02067; hypothetical protein; K12871 coile... 58.9 4e-09 cel:Y69A2AR.21 hypothetical protein; K12871 coiled-coil domain... 45.8 3e-05 dre:568158 slc44a5a, ctl5a, si:dkey-189n19.2, slc44a5; solute ... 30.0 1.7 dre:559505 myt1la, si:dkey-260n20.1; myelin transcription fact... 28.9 4.4 ath:AT2G29060 scarecrow transcription factor family protein 28.9 4.7 cpv:cgd7_1090 hypothetical protein 28.1 6.4 sce:YJR089W BIR1; Bir1p 27.7 8.7 > tgo:TGME49_079430 hypothetical protein ; K12871 coiled-coil domain-containing protein 12 Length=152 Score = 127 bits (319), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 58/93 (62%), Positives = 76/93 (81%), Gaps = 0/93 (0%) Query 10 SSSFELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRRP 69 S LRFRNYVP+D LR+FCLPRPS++ELEKQI EA A+ ++ +ED+++Q+ PRRP Sbjct 14 HSQVILRFRNYVPRDVVLRRFCLPRPSVEELEKQIDREATDAINSSANEDVVAQIAPRRP 73 Query 70 NWDLKRDVERKIAILSRRTDKAIIQLIREKIEQ 102 NWDLKRDVE+K+A+LSR+TD AI+ LIR KI+ Sbjct 74 NWDLKRDVEKKLAVLSRKTDMAIVDLIRMKIKN 106 > pfa:PF14_0490 conserved Plasmodium protein, unknown function; K12871 coiled-coil domain-containing protein 12 Length=147 Score = 77.0 bits (188), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 35/94 (37%), Positives = 65/94 (69%), Gaps = 1/94 (1%) Query 10 SSSFE-LRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRR 68 ++ +E LRF NY+P +++L++ C+P P ++ E ++ E + + +IL Q+ + Sbjct 3 TNDYENLRFYNYIPVNKELKKSCIPCPDTEDYEAKLNKEFDEELTKVFQGNILDQINAKD 62 Query 69 PNWDLKRDVERKIAILSRRTDKAIIQLIREKIEQ 102 N DLKRD+++K+ ILS++TDKA++QLI++KI + Sbjct 63 INADLKRDLKKKLDILSKKTDKAVVQLIKQKINE 96 > tpv:TP01_0018 hypothetical protein; K12871 coiled-coil domain-containing protein 12 Length=146 Score = 75.1 bits (183), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 5/86 (5%) Query 17 FRNYVPKDRKLRQFCLPRPSIDE---LEKQIALEAESAVQAAKDEDILSQVVPRRPNWDL 73 FRNY+P+D LR+ C + S+++ +E I + + + + EDILS V PRR NWDL Sbjct 29 FRNYIPRDENLRKLC--KSSLEDYSAIENTIDQQIDQTILNYQSEDILSLVRPRRQNWDL 86 Query 74 KRDVERKIAILSRRTDKAIIQLIREK 99 KR++ RK +LS RTD AI++L+RE+ Sbjct 87 KRELNRKRQVLSSRTDAAILRLLRER 112 > mmu:72654 Ccdc12, 2700094L05Rik, C76605; coiled-coil domain containing 12; K12871 coiled-coil domain-containing protein 12 Length=166 Score = 68.9 bits (167), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 38/102 (37%), Positives = 63/102 (61%), Gaps = 9/102 (8%) Query 4 EESSSLSSSFELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDI--- 60 EE + LR RNYVP+D L++ +P+ +E+++ + ++AAK E + Sbjct 46 EEGEEVGKHRGLRLRNYVPEDEDLKRRRVPQAKPVAVEEKV----KEQLEAAKPEPVIEE 101 Query 61 --LSQVVPRRPNWDLKRDVERKIAILSRRTDKAIIQLIREKI 100 L+ + PR+P+WDLKRDV +K+ L +RT +AI +LIRE++ Sbjct 102 VDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRERL 143 > dre:793027 ccdc12, MGC101038, zgc:101038; coiled-coil domain containing 12; K12871 coiled-coil domain-containing protein 12 Length=163 Score = 67.8 bits (164), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 36/99 (36%), Positives = 64/99 (64%), Gaps = 1/99 (1%) Query 3 VEESSSLSSSFELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDI-L 61 +E++ + EL+ RNY P+D +L++ +P+ ++ ++ + E+A E++ L Sbjct 43 LEDTETEDRHRELKLRNYTPEDVELKERQVPKAKPASVDDKVKDQLEAANPEPVIEEVDL 102 Query 62 SQVVPRRPNWDLKRDVERKIAILSRRTDKAIIQLIREKI 100 + + PR+P+WDLKRDV +K+ L RRT KAI +LIRE++ Sbjct 103 ANLAPRKPDWDLKRDVAKKLEKLERRTQKAIAELIRERL 141 > hsa:151903 CCDC12, FLJ39430, FLJ40801, MGC23918; coiled-coil domain containing 12; K12871 coiled-coil domain-containing protein 12 Length=179 Score = 67.8 bits (164), Expect = 9e-12, Method: Compositional matrix adjust. Identities = 37/92 (40%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Query 14 ELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDI-----LSQVVPRR 68 ELR RNYVP+D L++ +P+ +E+++ + ++AAK E + L+ + PR+ Sbjct 69 ELRLRNYVPEDEDLKKRRVPQAKPVAVEEKV----KEQLEAAKPEPVIEEVDLANLAPRK 124 Query 69 PNWDLKRDVERKIAILSRRTDKAIIQLIREKI 100 P+WDLKRDV +K+ L +RT +AI +LIRE++ Sbjct 125 PDWDLKRDVAKKLEKLKKRTQRAIAELIRERL 156 > ath:AT3G05070 hypothetical protein; K12871 coiled-coil domain-containing protein 12 Length=144 Score = 66.6 bits (161), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 37/99 (37%), Positives = 60/99 (60%), Gaps = 3/99 (3%) Query 1 EDVEESSSLSSSFELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDI 60 ED E+ + ++FRNYVP+ ++L+ L P + + E I + AV+ K ED Sbjct 33 EDGEDEAVEEDGPAMKFRNYVPQAKELQDGKLAPPELPKFEDPI-VALPPAVE--KKEDP 89 Query 61 LSQVVPRRPNWDLKRDVERKIAILSRRTDKAIIQLIREK 99 + P++PNWDL+RDV++K+ L RRT KA+ +L+ E+ Sbjct 90 FVNIAPKKPNWDLRRDVQKKLDKLERRTQKAMHKLMEEQ 128 > xla:100037064 hypothetical protein LOC100037064; K12871 coiled-coil domain-containing protein 12 Length=157 Score = 66.2 bits (160), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 60/92 (65%), Gaps = 9/92 (9%) Query 14 ELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQV-----VPRR 68 EL+ RNY P+D L++ +P+ +E+++ + ++AAK E I+ +V PR+ Sbjct 48 ELKLRNYTPQDEVLKERQVPQAKPISVEEKV----QEQLEAAKPEPIIEEVDLANLAPRK 103 Query 69 PNWDLKRDVERKIAILSRRTDKAIIQLIREKI 100 P+WDLKRDV +K+ L +RT +AI +LIRE++ Sbjct 104 PDWDLKRDVAKKLEKLEKRTQRAIAELIRERL 135 > xla:100037234 ccdc12; coiled-coil domain containing 12 Length=157 Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 36/92 (39%), Positives = 60/92 (65%), Gaps = 9/92 (9%) Query 14 ELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQV-----VPRR 68 EL+ RNY P+D L++ +P+ +E+++ + ++AAK E I+ +V PR+ Sbjct 48 ELKLRNYTPQDDVLKERQVPQAKPISVEEKV----KEQLEAAKPEPIIEEVDLANLAPRK 103 Query 69 PNWDLKRDVERKIAILSRRTDKAIIQLIREKI 100 P+WDLKRDV +K+ L +RT +AI +LIRE++ Sbjct 104 PDWDLKRDVAKKLEKLEKRTQRAIAELIRERL 135 > bbo:BBOV_I002710 19.m02067; hypothetical protein; K12871 coiled-coil domain-containing protein 12 Length=121 Score = 58.9 bits (141), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 7/89 (7%) Query 15 LRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAV----QAAKDEDILSQVVPRRPN 70 L F +YVPKD L++F R +++ +QI + +SA+ + ++D+LS V+P + N Sbjct 8 LVFHHYVPKDENLKRFV--RSDLEDY-RQIEEDIDSAINKIIEEHSNKDVLSLVLPSKQN 64 Query 71 WDLKRDVERKIAILSRRTDKAIIQLIREK 99 WDLKRD+ +L+ RTD AI++L++ + Sbjct 65 WDLKRDLRDSRQLLATRTDMAIMKLLQNQ 93 > cel:Y69A2AR.21 hypothetical protein; K12871 coiled-coil domain-containing protein 12 Length=169 Score = 45.8 bits (107), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 3/98 (3%) Query 4 EESSSLSSSFELRFRNYVPKDRKLRQFCLPRPSIDELEKQIALEAESAVQ-AAKDEDILS 62 E S+ S FRN+ P D Q +D ++++I + + A D L+ Sbjct 55 ETSTKKSREVGREFRNHKPDDAVGTQNV--DMDLDIVQREITEHLKDVLHEKAIDSVDLA 112 Query 63 QVVPRRPNWDLKRDVERKIAILSRRTDKAIIQLIREKI 100 + P++ +WDLKRD+E K+ L RRT KA+ +IR+++ Sbjct 113 MLAPKKIDWDLKRDIESKLQKLERRTQKAVATIIRQRL 150 > dre:568158 slc44a5a, ctl5a, si:dkey-189n19.2, slc44a5; solute carrier family 44, member 5a Length=728 Score = 30.0 bits (66), Expect = 1.7, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Query 28 RQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRRP 69 +QFC +P + +K +A Q +DED S +VP RP Sbjct 154 KQFC--KPGFNNPQKSVA-------QVLRDEDCPSMIVPSRP 186 > dre:559505 myt1la, si:dkey-260n20.1; myelin transcription factor 1-like, a Length=1257 Score = 28.9 bits (63), Expect = 4.4, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query 21 VPKDRKLRQFCLPRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRRPNWDL 73 V DR F + + ++ LEK IALE+E A + +D Q+V RR N L Sbjct 457 VASDRSDEAFDMTKGNLSLLEKAIALESERA-KVMRDRMASEQMVARRDNQRL 508 > ath:AT2G29060 scarecrow transcription factor family protein Length=1336 Score = 28.9 bits (63), Expect = 4.7, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 0/47 (0%) Query 33 PRPSIDELEKQIALEAESAVQAAKDEDILSQVVPRRPNWDLKRDVER 79 P+P + + K + +AESA+Q K + S+ +P W + D+ER Sbjct 815 PQPVNEIMVKSMFSDAESALQFKKGVEEASKFLPNSDQWVINLDIER 861 > cpv:cgd7_1090 hypothetical protein Length=396 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 5/57 (8%) Query 39 ELEKQIALEAESAVQAAKDEDILSQVVPRRPNWDLKRDVERKIAILSRRTDKAIIQL 95 +++ QI + SA D+DILS V ++ LK E ++R D+AIIQ+ Sbjct 256 KIKPQIKIHGLSANSGLSDKDILSAV-----SFQLKNSNEGFAIAINRNNDEAIIQV 307 > sce:YJR089W BIR1; Bir1p Length=954 Score = 27.7 bits (60), Expect = 8.7, Method: Compositional matrix adjust. Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 11/61 (18%) Query 33 PRPSIDELEKQIALEAESAVQAAKDEDIL----SQVVPRRPNWDLKRDVERKIAILSRRT 88 PR DE + + +L SA KD+D++ S ++ RDV RK AIL T Sbjct 396 PRKIFDEEDSEHSLNNNSANGDNKDKDLVIDFTSHIIKN-------RDVGRKNAILDDST 448 Query 89 D 89 D Sbjct 449 D 449 Lambda K H 0.316 0.132 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2031832220 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40