bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2105_orf1 Length=103 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_109120 60s ribosomal protein L4, putative ; K02930 ... 78.2 6e-15 pfa:PFE0350c 60S ribosomal protein L4, putative; K02930 large ... 33.9 0.12 cpv:cgd6_3190 60S ribosomal protein-like 29.6 2.4 hsa:10319 LAMC3, DKFZp434E202; laminin, gamma 3; K06247 lamini... 28.1 6.4 xla:398678 rpl4-b, MGC64318, l1b, rpl1b; ribosomal protein L4;... 28.1 7.6 xla:380237 rpl4-a, MGC130828, MGC53834, rpl-4, rpl1a; ribosoma... 28.1 7.9 > tgo:TGME49_109120 60s ribosomal protein L4, putative ; K02930 large subunit ribosomal protein L4e Length=416 Score = 78.2 bits (191), Expect = 6e-15, Method: Compositional matrix adjust. Identities = 45/74 (60%), Positives = 53/74 (71%), Gaps = 0/74 (0%) Query 5 KRRQHKNLLTNAAVHKRVNPAASNLKRLAKLQQTEGTRARDIILRKKTKCREERKKHRKA 64 KR Q KNLL N AV RVNPAA NLK LA+L QTEGT+ R ++LRKK REE KKHR++ Sbjct 315 KRGQKKNLLKNHAVLCRVNPAARNLKILARLAQTEGTKQRALVLRKKQANREEHKKHRQS 374 Query 65 AKARMQQILQQFSD 78 A+ +I Q FSD Sbjct 375 ARRFAAEIRQAFSD 388 > pfa:PFE0350c 60S ribosomal protein L4, putative; K02930 large subunit ribosomal protein L4e Length=411 Score = 33.9 bits (76), Expect = 0.12, Method: Compositional matrix adjust. Identities = 28/72 (38%), Positives = 42/72 (58%), Gaps = 7/72 (9%) Query 5 KRRQHKNLLTNAAVHKRVNPAASNLKRLAKLQQTEGTRARDIILRKKTKCREERKKHRKA 64 KR Q+KN LTN AV R+NPA L+ LA L R R IL +K+K ++E++ ++ Sbjct 311 KRLQNKNSLTNFAVRCRLNPAYKLLRSLAVL------RMRKSIL-EKSKNKKEKRVQKQI 363 Query 65 AKARMQQILQQF 76 K +Q+I + Sbjct 364 QKKELQKINHDY 375 > cpv:cgd6_3190 60S ribosomal protein-like Length=394 Score = 29.6 bits (65), Expect = 2.4, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 12/73 (16%) Query 10 KNLLTNAAVHKRVNPAASNLKRLAKLQQTEGTRARDIILRKKTKCREERKKHRKAAKARM 69 KN LTN +NPA ++L++ A+L Q GTR I K+ +KAA + Sbjct 324 KNNLTNLTKRACLNPAYTSLRKSARLAQIPGTRLHAI------------KQRQKAANRAL 371 Query 70 QQILQQFSDTAAA 82 ++ ++Q S+TA A Sbjct 372 KKSIKQKSETALA 384 > hsa:10319 LAMC3, DKFZp434E202; laminin, gamma 3; K06247 laminin, gamma 3 Length=1575 Score = 28.1 bits (61), Expect = 6.4, Method: Composition-based stats. Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 11/93 (11%) Query 5 KRRQHKNLLTNAAVHKRVNPAASNLKRLAKLQQTEGTRARDIILRKKTKCREERKKHRKA 64 K +Q + +L NAA P +S+ K+ + + A+D K RE ++ HR+A Sbjct 1376 KTKQAERMLGNAA------PLSSSAKKKGREAEV---LAKDSAKLAKALLRERKQAHRRA 1426 Query 65 AK--ARMQQILQQFSDTAAANIAATKEQQQKQQ 95 ++ ++ Q LQQ S A+ A +E ++ ++ Sbjct 1427 SRLTSQTQATLQQASQQVLASEARRQELEEAER 1459 > xla:398678 rpl4-b, MGC64318, l1b, rpl1b; ribosomal protein L4; K02930 large subunit ribosomal protein L4e Length=401 Score = 28.1 bits (61), Expect = 7.6, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query 4 AKRRQ-HKNLLTNAAVHKRVNPAASNLKRLAKLQQTEGTRARD 45 KRR+ KN L N + R+NP A +R A LQQ E +A++ Sbjct 313 VKRRELKKNPLKNLRIMMRLNPYAKTARRHAILQQLENIKAKE 355 > xla:380237 rpl4-a, MGC130828, MGC53834, rpl-4, rpl1a; ribosomal protein L4; K02930 large subunit ribosomal protein L4e Length=396 Score = 28.1 bits (61), Expect = 7.9, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Query 4 AKRRQ-HKNLLTNAAVHKRVNPAASNLKRLAKLQQTEGTRARD 45 KRR+ KN L N + R+NP A +R A LQQ E +A++ Sbjct 313 VKRRELKKNPLKNLRIMMRLNPYAKTARRHAILQQLENIKAKE 355 Lambda K H 0.312 0.119 0.310 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2027061836 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40