bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2144_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_078490 hypothetical protein ; K13125 nitric oxide s... 87.4 1e-17 pfa:PFE0900w conserved protein, unknown function; K13125 nitri... 87.0 1e-17 bbo:BBOV_II003220 18.m06270; hypothetical protein; K13125 nitr... 63.9 1e-10 hsa:51070 NOSIP; nitric oxide synthase interacting protein; K1... 56.2 2e-08 dre:492793 nosip, wu:fb80a11, zgc:101669; nitric oxide synthas... 53.9 1e-07 tpv:TP04_0271 hypothetical protein; K13125 nitric oxide syntha... 53.1 2e-07 xla:414557 nosip, MGC78783; nitric oxide synthase interacting ... 52.4 3e-07 cel:R05G6.4 hypothetical protein; K13125 nitric oxide synthase... 49.7 3e-06 mmu:66394 Nosip, 2310061K06Rik, CGI-25, MGC115777; nitric oxid... 35.8 0.035 dre:100332064 nitric oxide synthase-interacting protein-like 32.7 0.29 dre:559280 MGC171819; zgc:171819 28.9 3.9 tgo:TGME49_088250 hypothetical protein 28.9 4.7 > tgo:TGME49_078490 hypothetical protein ; K13125 nitric oxide synthase-interacting protein Length=322 Score = 87.4 bits (215), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 0/90 (0%) Query 12 ENTPDELQAKPKTPQKGLCCPITGATLRIKQLVTVKPNLASKEDTENTRWLCALSGREIS 71 ENTP + K P++ L CPIT L++KQLV + P L ++TE RW C +S R I+ Sbjct 196 ENTPSAPPEEAKPPKRSLECPITRKPLKLKQLVYLNPELLDDKETEFNRWSCKISKRAIT 255 Query 72 HQKAAVVKTTGQVILLECLEKLVFGKRGAL 101 +QKAA V TG VIL+EC+EK V K+G Sbjct 256 NQKAAAVIPTGDVILMECIEKYVLNKKGGF 285 > pfa:PFE0900w conserved protein, unknown function; K13125 nitric oxide synthase-interacting protein Length=270 Score = 87.0 bits (214), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 4/101 (3%) Query 5 AKNFWVPENTP----DELQAKPKTPQKGLCCPITGATLRIKQLVTVKPNLASKEDTENTR 60 + NFW+ NT D +Q K K P K L CPIT L++ +L+T+ P + D+EN Sbjct 135 SNNFWLSCNTSKVKKDTIQKKLKPPSKNLICPITKKPLKMNELITINPEVIKNGDSENGG 194 Query 61 WLCALSGREISHQKAAVVKTTGQVILLECLEKLVFGKRGAL 101 W+C+ S + I H KA ++K TG++IL E ++GK+ + Sbjct 195 WVCSFSKKNIDHHKAVLLKKTGKIILKSFFENFIYGKKNSY 235 > bbo:BBOV_II003220 18.m06270; hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=262 Score = 63.9 bits (154), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 32/94 (34%), Positives = 55/94 (58%), Gaps = 5/94 (5%) Query 3 ARAKNFWVP----ENTPDELQAK-PKTPQKGLCCPITGATLRIKQLVTVKPNLASKEDTE 57 + +FWV + DE P+ P+K L CPITG L+IK+LV + P+L+ D Sbjct 134 VKDSSFWVAGVSGNSKGDETSTSLPEPPKKILRCPITGKPLKIKELVDIHPDLSENTDNG 193 Query 58 NTRWLCALSGREISHQKAAVVKTTGQVILLECLE 91 + W+C++S R I H++ + ++TG+++L +E Sbjct 194 DPIWICSVSQRPIGHKEVMLNRSTGRLVLRRYIE 227 > hsa:51070 NOSIP; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=301 Score = 56.2 bits (134), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 32/95 (33%), Positives = 54/95 (56%), Gaps = 7/95 (7%) Query 7 NFWVPENTPDELQAKPKTPQKGLCCPITGATLRIKQLVTVKPN-LASKED-----TENTR 60 +FW+P TP+ K + P + + CP++G LR+ L V L S D T + R Sbjct 161 SFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSER 220 Query 61 WLCALSGREISHQKA-AVVKTTGQVILLECLEKLV 94 ++CA++ +S+ AV++ +G V+ LEC+EKL+ Sbjct 221 YVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLI 255 > dre:492793 nosip, wu:fb80a11, zgc:101669; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=304 Score = 53.9 bits (128), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 33/98 (33%), Positives = 57/98 (58%), Gaps = 13/98 (13%) Query 7 NFWVPENTPDELQAKP---KTPQKGLCCPITGATLRIKQLVTVK-----PNLASKE-DTE 57 +FW+P TP +AKP K P K + CP++G L++ L+TV+ P+L T Sbjct 164 SFWIPSLTP---EAKPTLLKKPSKTVSCPMSGRPLKMSDLITVRFTPLDPSLDRVALLTR 220 Query 58 NTRWLCALSGREISHQ-KAAVVKTTGQVILLECLEKLV 94 R++CA++ + + AV++ +G V+ +EC+EKL+ Sbjct 221 QDRYVCAVTKDTLGNSVPCAVLRPSGVVVTMECVEKLI 258 > tpv:TP04_0271 hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=241 Score = 53.1 bits (126), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Query 22 PKTPQKGLCCPITGATLRIKQLVTVKPNLASKEDTENTR--WLCALSGREISHQKAAVVK 79 P P+ L CPI+G L++K L+ + P+ S D+ ++ WLC++S + I H +A K Sbjct 133 PPKPKNLLSCPISGRPLKVKDLIDLDPDTRSTSDSPSSEVVWLCSVSKKPILHNQAYAYK 192 Query 80 TTGQVIL 86 G++++ Sbjct 193 KNGKIVM 199 > xla:414557 nosip, MGC78783; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=298 Score = 52.4 bits (124), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 29/99 (29%), Positives = 56/99 (56%), Gaps = 15/99 (15%) Query 7 NFWVPENTPDELQAKPKTPQKGLCCPITGATLRIKQLVTV----------KPNLASKEDT 56 +FW+P TP+ + K P K + CP++G L++K L+ V + L +++D Sbjct 158 SFWIPSLTPEAKTSLVKKPDKTVYCPMSGRPLKMKDLMPVNFTRVDEKVDRVGLINRQD- 216 Query 57 ENTRWLCALSGREISHQ-KAAVVKTTGQVILLECLEKLV 94 R++CA++ + + AV++ +G V+ +EC+EKL+ Sbjct 217 ---RYVCAVTRDMLGNSVPCAVLRPSGAVVTMECVEKLI 252 > cel:R05G6.4 hypothetical protein; K13125 nitric oxide synthase-interacting protein Length=310 Score = 49.7 bits (117), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/92 (27%), Positives = 53/92 (57%), Gaps = 2/92 (2%) Query 7 NFWVPENTPDELQAKPKTPQKGLCCPITGATLRIKQLVTVKPN-LASKEDTENTRWLCAL 65 +FW+PE P + K + P + CP++G +++K+L+ VK + E + ++LC + Sbjct 175 SFWIPELNPTAVATKLEKPSSKVLCPVSGKPIKLKELLEVKFTPMPGTETAAHRKFLCPV 234 Query 66 SGREISH-QKAAVVKTTGQVILLECLEKLVFG 96 + E+++ + A +K + V+ + +EKL+ G Sbjct 235 TRDELTNTTRCAYLKKSKSVVKYDVVEKLIKG 266 > mmu:66394 Nosip, 2310061K06Rik, CGI-25, MGC115777; nitric oxide synthase interacting protein; K13125 nitric oxide synthase-interacting protein Length=276 Score = 35.8 bits (81), Expect = 0.035, Method: Compositional matrix adjust. Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 20/89 (22%) Query 7 NFWVPENTPDELQAKPKTPQKGLCCPITGATLRIKQLVTVKPNLASKEDTENTRWLCALS 66 +FW+P TP+ K L P+ + R+ + T + R++CA++ Sbjct 161 SFWIPSLTPEAKATK-------LEKPLDDSVDRVGLI------------TRSERYVCAVT 201 Query 67 GREISHQKA-AVVKTTGQVILLECLEKLV 94 +S+ AV++ +G V+ LEC+EKL+ Sbjct 202 RDSLSNATPCAVLRPSGAVVTLECVEKLI 230 > dre:100332064 nitric oxide synthase-interacting protein-like Length=115 Score = 32.7 bits (73), Expect = 0.29, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 7/69 (10%) Query 33 ITGATLRIKQLVTVK-----PNLASKED-TENTRWLCALSGREISHQ-KAAVVKTTGQVI 85 ++G L++ L+TV+ P+L T R++CA++ + + AV++ +G V+ Sbjct 1 MSGRPLKMSDLITVRFTPLDPSLDRVALLTRQDRYVCAVTKDTLGNSVPCAVLRPSGVVV 60 Query 86 LLECLEKLV 94 +EC+EKL+ Sbjct 61 TMECVEKLI 69 > dre:559280 MGC171819; zgc:171819 Length=797 Score = 28.9 bits (63), Expect = 3.9, Method: Compositional matrix adjust. Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 0/38 (0%) Query 28 GLCCPITGATLRIKQLVTVKPNLASKEDTENTRWLCAL 65 GLC P A L QL+ P A ED E W CA+ Sbjct 510 GLCLPKLLAPLIRHQLIGWNPLQAESEDFEALPWYCAV 547 > tgo:TGME49_088250 hypothetical protein Length=1843 Score = 28.9 bits (63), Expect = 4.7, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 0/53 (0%) Query 45 TVKPNLASKEDTENTRWLCALSGREISHQKAAVVKTTGQVILLECLEKLVFGK 97 T KP A K W + G + + V+ G+V+LL C ++LV + Sbjct 922 TAKPLEAGKTPGARIIWGATVVGMSAASAREVSVRDDGEVLLLRCPDRLVVAR 974 Lambda K H 0.316 0.131 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2036602604 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40