bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2322_orf1 Length=142 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_018200 UDP-N-acetylglucosamine pyrophosphorylase, p... 165 3e-41 cpv:cgd7_1830 secreted UDP-N-acetylglucosamine pyrophosphoryla... 149 4e-36 ath:AT5G52560 ATUSP; ATUSP (ARABIDOPSIS THALIANA UDP-SUGAR PYR... 136 3e-32 pfa:PFE0875c conserved Plasmodium protein, unknown function 114 1e-25 xla:447461 tgif2, MGC81646, xtgif2; TGFB-induced factor homeob... 30.4 1.8 cpv:cgd6_2430 BTF domain, basal transcription factor 30.0 2.8 tgo:TGME49_119580 hypothetical protein 29.6 3.1 hsa:1778 DYNC1H1, DHC1, DHC1a, DKFZp686P2245, DNCH1, DNCL, DNE... 29.3 4.7 tgo:TGME49_114780 myosin G 28.9 6.1 sce:YOL091W SPO21, MPC70; Component of the meiotic outer plaqu... 28.9 6.2 mmu:13424 Dync1h1, 9930018I23Rik, AI894280, DHC1, DHC1a, DNCL,... 28.9 6.2 hsa:643677 C13orf40, DKFZp434L2319, DKFZp686P1429, FLJ40176, F... 28.5 7.9 ath:AT4G03010 leucine-rich repeat family protein 28.5 8.1 pfa:PFB0495w conserved Plasmodium protein 28.1 9.9 > tgo:TGME49_018200 UDP-N-acetylglucosamine pyrophosphorylase, putative ; K12447 UDP-sugar pyrophosphorylase [EC:2.7.7.64] Length=655 Score = 165 bits (418), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 80/141 (56%), Positives = 99/141 (70%), Gaps = 2/141 (1%) Query 2 FTMNSTAVPRRPGEAVGSICRLVSQE-KELTINVEYNLLDSLLKGAGQEGDKAGPLGYSS 60 F MN+ VPR+P EA+G+IC+L ++ +TINVEYN+L LLK G+E D A G+SS Sbjct 306 FAMNTVTVPRKPAEAMGAICKLQKKDGSSITINVEYNVLGPLLKAEGRE-DGATSEGFSS 364 Query 61 LPGNTNAIVLQLSNYFKALNQSKGMVPEFINPKFKDATKTSFKSPARLESMMQDLPLQLN 120 PGNTNA+V + Y L + G VPEF+NPK+KD TKTSFKSP RLE MMQD P + Sbjct 365 FPGNTNALVFSIEPYCSVLEMTGGTVPEFVNPKYKDGTKTSFKSPTRLECMMQDFPRLFS 424 Query 121 PTDKVGFVELPRWCCFSPVKN 141 PT VGF+EL RW C+S VKN Sbjct 425 PTTPVGFIELDRWFCYSCVKN 445 > cpv:cgd7_1830 secreted UDP-N-acetylglucosamine pyrophosphorylase family protein, signal peptide Length=654 Score = 149 bits (375), Expect = 4e-36, Method: Composition-based stats. Identities = 73/144 (50%), Positives = 95/144 (65%), Gaps = 2/144 (1%) Query 1 NFTMNSTAVPRRPGEAVGSICRLVSQE-KELTINVEYNLLDSLLKGAGQEGDKAG-PLGY 58 +F MNS +PR P EAVG++C+L + K++TIN EYN L LLK G D A GY Sbjct 316 SFVMNSLTIPRIPCEAVGALCKLRYPDGKKITINTEYNQLTPLLKSCGLGSDFADEKTGY 375 Query 59 SSLPGNTNAIVLQLSNYFKALNQSKGMVPEFINPKFKDATKTSFKSPARLESMMQDLPLQ 118 S PGN+N + + + Y K L ++ G+VPEF+NPK+ D+TKT+FKSP RLE MMQD+PL Sbjct 376 SPFPGNSNVLFISMDYYMKTLEKTGGVVPEFVNPKYLDSTKTAFKSPTRLECMMQDIPLL 435 Query 119 LNPTDKVGFVELPRWCCFSPVKNS 142 KVG V++ RW FS KNS Sbjct 436 FEADYKVGCVQMQRWATFSACKNS 459 > ath:AT5G52560 ATUSP; ATUSP (ARABIDOPSIS THALIANA UDP-SUGAR PYROPHOSPHORYLASE); UTP-monosaccharide-1-phosphate uridylyltransferase/ UTP:arabinose-1-phosphate uridylyltransferase/ UTP:galactose-1-phosphate uridylyltransferase/ UTP:glucose-1-phosphate uridylyltransferase/ UTP:xylose-1-phosphate uridylyltransferase/ glucuronate-1-phosphate uridylyltransferase; K12447 UDP-sugar pyrophosphorylase [EC:2.7.7.64] Length=614 Score = 136 bits (342), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 67/143 (46%), Positives = 94/143 (65%), Gaps = 2/143 (1%) Query 2 FTMNSTAVPRRPGEAVGSICRLVSQE-KELTINVEYNLLDSLLKGAG-QEGDKAGPLGYS 59 + +NS AVPR+ EA+G I +L + + + INVEYN LD LL+ +G +GD G+S Sbjct 304 YHVNSLAVPRKAKEAIGGISKLTHVDGRSMVINVEYNQLDPLLRASGFPDGDVNCETGFS 363 Query 60 SLPGNTNAIVLQLSNYFKALNQSKGMVPEFINPKFKDATKTSFKSPARLESMMQDLPLQL 119 PGN N ++L+L Y L ++ G + EF+NPK+KD+TKT+FKS RLE MMQD P L Sbjct 364 PFPGNINQLILELGPYKDELQKTGGAIKEFVNPKYKDSTKTAFKSSTRLECMMQDYPKTL 423 Query 120 NPTDKVGFVELPRWCCFSPVKNS 142 PT +VGF + W ++PVKN+ Sbjct 424 PPTARVGFTVMDIWLAYAPVKNN 446 > pfa:PFE0875c conserved Plasmodium protein, unknown function Length=855 Score = 114 bits (285), Expect = 1e-25, Method: Composition-based stats. Identities = 53/114 (46%), Positives = 79/114 (69%), Gaps = 1/114 (0%) Query 4 MNSTAVPRRPGEAVGSICRLVSQEKELTINVEYNLLDSLLKGAGQEGDKAGPLGYSSLPG 63 MN AV R+PGE +G++C L + EK +T+N+EYN+ DSLL G + + G+S PG Sbjct 460 MNFLAVSRKPGEEIGALCTLNNNEKSMTVNLEYNIFDSLLSSNGIK-EVIQKDGFSLYPG 518 Query 64 NTNAIVLQLSNYFKALNQSKGMVPEFINPKFKDATKTSFKSPARLESMMQDLPL 117 NT+AI+ +++ Y + L ++ G +PE+INPK+ D T+ FK P R+ESMMQD+ L Sbjct 519 NTSAILYEINKYNEILKKTNGNIPEYINPKYMDNTRDHFKCPTRIESMMQDIAL 572 Score = 28.5 bits (62), Expect = 7.5, Method: Composition-based stats. Identities = 12/18 (66%), Positives = 13/18 (72%), Gaps = 0/18 (0%) Query 125 VGFVELPRWCCFSPVKNS 142 VG EL R CFSPVKN+ Sbjct 651 VGVTELDRCLCFSPVKNN 668 > xla:447461 tgif2, MGC81646, xtgif2; TGFB-induced factor homeobox 2 Length=256 Score = 30.4 bits (67), Expect = 1.8, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query 60 SLPGNTNAIVLQLSNYFKALNQSKGMVPEFINPKFKD 96 SL G TN VLQ+ N+F +N + ++PE + KD Sbjct 59 SLSGQTNLTVLQICNWF--INARRRILPELLRKDGKD 93 > cpv:cgd6_2430 BTF domain, basal transcription factor Length=186 Score = 30.0 bits (66), Expect = 2.8, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query 84 GMVPEFINPKFKD--ATKTSFKSPARLESMMQDLPLQLNPTDKVGFVELPRW 133 G F NPK + AT T + E +++DLP Q+NP D F+ P++ Sbjct 101 GTCLHFSNPKLQASVATNTYILTGNPQEKLIKDLPQQINPMDLSAFLNDPKF 152 > tgo:TGME49_119580 hypothetical protein Length=1593 Score = 29.6 bits (65), Expect = 3.1, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 0/51 (0%) Query 64 NTNAIVLQLSNYFKALNQSKGMVPEFINPKFKDATKTSFKSPARLESMMQD 114 N L ++N++ + SK +V + + +F++A KTS S + E QD Sbjct 357 NEERQALVVTNHYAGIFSSKRVVLTYTSHEFREAAKTSLPSLKKREREKQD 407 > hsa:1778 DYNC1H1, DHC1, DHC1a, DKFZp686P2245, DNCH1, DNCL, DNECL, DYHC, Dnchc1, HL-3, KIAA0325, p22; dynein, cytoplasmic 1, heavy chain 1; K10413 dynein heavy chain 1, cytosolic Length=4646 Score = 29.3 bits (64), Expect = 4.7, Method: Composition-based stats. Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 9/64 (14%) Query 59 SSLPGN----TNAIVLQLSNYFKALNQSKGMVPEFINPKFKD--ATKTSFKSPA---RLE 109 SSLP + NAI+L+ N + + G EFI ++KD T+TSF A LE Sbjct 3565 SSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDAFRKNLE 3624 Query 110 SMMQ 113 S ++ Sbjct 3625 SALR 3628 > tgo:TGME49_114780 myosin G Length=2059 Score = 28.9 bits (63), Expect = 6.1, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 8/71 (11%) Query 11 RRPGEAVGSICRLVSQEKELTINVEYNLLDSLLKGAGQEGDKAGPLG------YSSLPGN 64 RRPG++ G VS E+E + V+ L D + +GD G L + L + Sbjct 1503 RRPGDSTGQ--GAVSAERETRMYVQIRLADGSQRRLALDGDLPGDLSRRLVKDLNLLGAD 1560 Query 65 TNAIVLQLSNY 75 + AI+ QLS Y Sbjct 1561 SWAIMEQLSQY 1571 > sce:YOL091W SPO21, MPC70; Component of the meiotic outer plaque of the spindle pole body, involved in modifying the meiotic outer plaque that is required prior to prospore membrane formation Length=609 Score = 28.9 bits (63), Expect = 6.2, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Query 58 YSSLPGNTNAIVLQLSNYF---KALNQSKG 84 Y+S+ GN N I+LQ +N+F K + QSKG Sbjct 160 YNSIKGNENDILLQNNNHFRHNKEIPQSKG 189 > mmu:13424 Dync1h1, 9930018I23Rik, AI894280, DHC1, DHC1a, DNCL, Dnchc1, Dnec1, Dnecl, Loa, MAP1C, P22, Swl, mKIAA0325; dynein cytoplasmic 1 heavy chain 1; K10413 dynein heavy chain 1, cytosolic Length=4644 Score = 28.9 bits (63), Expect = 6.2, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Query 59 SSLPGN----TNAIVLQLSNYFKALNQSKGMVPEFINPKFKD--ATKTSFKSPA 106 SSLP + NAI+L+ N + + G EFI ++KD T+TSF A Sbjct 3563 SSLPADDLCTENAIMLKRFNRYPLIIDPSGQATEFIMNEYKDRKITRTSFLDDA 3616 > hsa:643677 C13orf40, DKFZp434L2319, DKFZp686P1429, FLJ40176, FLJ43996; chromosome 13 open reading frame 40 Length=7081 Score = 28.5 bits (62), Expect = 7.9, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 70 LQLSNYFKALNQSKGMVPEFIN 91 L FK +NQ+KG+VPE +N Sbjct 1391 LDFKTKFKKINQTKGLVPECLN 1412 > ath:AT4G03010 leucine-rich repeat family protein Length=395 Score = 28.5 bits (62), Expect = 8.1, Method: Compositional matrix adjust. Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 6/85 (7%) Query 13 PGEAVGSICRLVSQEKELT-INVEYNLLDSLLKGAGQE--GDKAGPLGYSSLPGN---TN 66 PG +GS+ +SQ K L + + N + + + E G K L Y+ L G+ + Sbjct 106 PGRIMGSLPHTISQSKNLRFLAISRNFISGEIPASLSELRGLKTLDLSYNQLTGSIPPSI 165 Query 67 AIVLQLSNYFKALNQSKGMVPEFIN 91 + +LSN N G +P+F++ Sbjct 166 GSLPELSNLILCHNHLNGSIPQFLS 190 > pfa:PFB0495w conserved Plasmodium protein Length=1121 Score = 28.1 bits (61), Expect = 9.9, Method: Composition-based stats. Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 10/77 (12%) Query 28 KELTINVEYNLLDSLLKGAGQEGDKAGPLGYSSLP-GNTNAIVLQLSNYFKALNQSKGMV 86 KEL I+++YN++D L+K Y S+ N + I + LSN ++ ++ Sbjct 713 KEL-IHLKYNIIDDLIKNYLNT--------YKSISIDNISKIFISLSNSKYTCEVNENLL 763 Query 87 PEFINPKFKDATKTSFK 103 E + +F+ TKTS K Sbjct 764 LESLQSEFEKVTKTSKK 780 Lambda K H 0.315 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2683748972 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40