bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2336_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_024350 aminopeptidase N, putative (EC:3.4.11.2); K0... 110 1e-24 ath:AT1G63770 peptidase M1 family protein; K01256 aminopeptida... 90.1 1e-18 tgo:TGME49_021310 aminopeptidase N, putative (EC:3.4.11.2) 77.8 7e-15 eco:b0932 pepN, ECK0923, JW0915; aminopeptidase N (EC:3.4.11.2... 72.8 3e-13 tpv:TP01_0397 alpha-aminoacylpeptide hydrolase (EC:3.4.11.2); ... 72.0 5e-13 cpv:cgd8_3430 zincin/aminopeptidase N like metalloprotease ; K... 68.9 4e-12 pfa:MAL13P1.56 M1-family aminopeptidase (EC:3.4.11.-); K13725 ... 63.5 2e-10 tgo:TGME49_024460 aminopeptidase N, putative (EC:3.4.11.2) 61.6 6e-10 bbo:BBOV_IV005930 23.m06519; aminopeptidase (EC:3.4.11.2); K01... 59.3 3e-09 xla:414652 lap3, MGC81140; leucine aminopeptidase 3; K11142 cy... 30.0 1.9 sce:YPR160W GPH1; Gph1p (EC:2.4.1.1); K00688 starch phosphoryl... 28.9 4.7 cpv:cgd5_1540 hypothetical protein 28.5 5.1 cpv:cgd2_3030 hypothetical protein 28.1 6.7 > tgo:TGME49_024350 aminopeptidase N, putative (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=1419 Score = 110 bits (275), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 55/99 (55%), Positives = 70/99 (70%), Gaps = 1/99 (1%) Query 2 SDLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKVD 61 SD+ + E V LQ+H FT KNPNRLR+L +F N P FH KD GY ++AD+VL VD Sbjct 1299 SDVRNVTETVKELQKHADFTAKNPNRLRALIFSFTRN-PQFHNKDGAGYALLADSVLAVD 1357 Query 62 SFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRIRDTP 100 FNPQ AAR AGAFL W++YD+ RQ++M +QL RI + P Sbjct 1358 RFNPQIAARGAGAFLQWKKYDETRQREMLKQLRRIANAP 1396 > ath:AT1G63770 peptidase M1 family protein; K01256 aminopeptidase N [EC:3.4.11.2] Length=987 Score = 90.1 bits (222), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 42/96 (43%), Positives = 57/96 (59%), Gaps = 0/96 (0%) Query 1 ASDLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKV 60 SD+P VE V L H AF +NPN++ SL F + +FH KD GY+ + D V+++ Sbjct 872 TSDIPGNVENVKKLLDHPAFDLRNPNKVYSLIGGFCGSPVNFHAKDGSGYKFLGDIVVQL 931 Query 61 DSFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRI 96 D NPQ A+R+ AF W+RYD+ RQ K QL I Sbjct 932 DKLNPQVASRMVSAFSRWKRYDETRQGLAKAQLEMI 967 > tgo:TGME49_021310 aminopeptidase N, putative (EC:3.4.11.2) Length=966 Score = 77.8 bits (190), Expect = 7e-15, Method: Compositional matrix adjust. Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 1/100 (1%) Query 2 SDLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPH-FHRKDAKGYQVVADAVLKV 60 S LP+ ++R+ L++H + PN +R+L++ F++ P FHR+D GY++ + + Sbjct 851 SSLPETLDRIRELEKHPEYKPLVPNFVRALYSTFMHGNPSVFHRRDGAGYELAFVFLQSM 910 Query 61 DSFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRIRDTP 100 D NP+ A+R A AFL W++YDK RQ + + L R+ + P Sbjct 911 DRINPRTASRAATAFLSWKKYDKERQGRARSVLERLANLP 950 > eco:b0932 pepN, ECK0923, JW0915; aminopeptidase N (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=870 Score = 72.8 bits (177), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 1/91 (1%) Query 8 VERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPH-FHRKDAKGYQVVADAVLKVDSFNPQ 66 +E V L QH +FT NPNR+RSL AF + P FH +D GY + + + ++S NPQ Sbjct 762 LETVRGLLQHRSFTMSNPNRIRSLIGAFAGSNPAAFHAEDGSGYLFLVEMLTDLNSRNPQ 821 Query 67 AAARLAGAFLPWQRYDKHRQQQMKEQLIRIR 97 A+RL + +RYD RQ++M+ L +++ Sbjct 822 VASRLIEPLIRLKRYDAKRQEKMRAALEQLK 852 > tpv:TP01_0397 alpha-aminoacylpeptide hydrolase (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=1020 Score = 72.0 bits (175), Expect = 5e-13, Method: Composition-based stats. Identities = 37/99 (37%), Positives = 51/99 (51%), Gaps = 1/99 (1%) Query 2 SDLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKVD 61 S+L ++ V L H F NPNR SL T F Y +FH+ + +GY+ + D++L VD Sbjct 906 SELESSLDTVKDLMSHKDFVLSNPNRFNSLVTVFTYGE-NFHKDNGEGYKFLTDSILTVD 964 Query 62 SFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRIRDTP 100 NP +AR L + + R MK QL RI TP Sbjct 965 PVNPHVSARCCTKLLKFAMLEPKRSGLMKAQLERIFSTP 1003 > cpv:cgd8_3430 zincin/aminopeptidase N like metalloprotease ; K01256 aminopeptidase N [EC:3.4.11.2] Length=936 Score = 68.9 bits (167), Expect = 4e-12, Method: Composition-based stats. Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 3/100 (3%) Query 4 LPDQVERVLSLQQHDAFTFK---NPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKV 60 +PD VERV+++ + K NP SL F N F+RKD GY VADA++ + Sbjct 822 IPDNVERVINIYHSNPQFIKYRENPTIFSSLVGTFASNFVAFNRKDGLGYSFVADAIILM 881 Query 61 DSFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRIRDTP 100 D NP +AA ++ AF + D+ R+ +KE ++RI +P Sbjct 882 DKVNPMSAASVSRAFTKVLKLDEGRRNLLKENVVRILQSP 921 > pfa:MAL13P1.56 M1-family aminopeptidase (EC:3.4.11.-); K13725 M1-family aminopeptidase [EC:3.4.11.-] Length=1085 Score = 63.5 bits (153), Expect = 2e-10, Method: Composition-based stats. Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 0/99 (0%) Query 2 SDLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKVD 61 SD D E + L+ KNPN +R+++ F N FH KGY+++A+ + K D Sbjct 970 SDRKDIYEILKKLENEVLKDSKNPNDIRAVYLPFTNNLRRFHDISGKGYKLIAEVITKTD 1029 Query 62 SFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRIRDTP 100 FNP A +L F W + D RQ+ M ++ + P Sbjct 1030 KFNPMVATQLCEPFKLWNKLDTKRQELMLNEMNTMLQEP 1068 > tgo:TGME49_024460 aminopeptidase N, putative (EC:3.4.11.2) Length=970 Score = 61.6 bits (148), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 1/83 (1%) Query 6 DQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKVDSFNP 65 D +ERV L+QH AF P SLF F + P FH K GY +V D + +D N Sbjct 856 DTLERVAQLRQHSAFHPFIPGSAYSLFGTFSSSSPQFHSKTGAGYALVLDFLTMIDEHNS 915 Query 66 QAAARLAG-AFLPWQRYDKHRQQ 87 ++R+AG AF W+R+ R++ Sbjct 916 LVSSRIAGVAFANWKRFTSPRRE 938 > bbo:BBOV_IV005930 23.m06519; aminopeptidase (EC:3.4.11.2); K01256 aminopeptidase N [EC:3.4.11.2] Length=846 Score = 59.3 bits (142), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 1/97 (1%) Query 1 ASDLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKV 60 +SD D ++RV L H +T KNPNR SL AF + FH GY+ +AD +L V Sbjct 725 SSDSADCLDRVRMLSTHKDYTNKNPNRANSLVRAFTRS-IRFHDPSGSGYKFMADQILLV 783 Query 61 DSFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRIR 97 D N ++ A +++ D R+ M +QL RI+ Sbjct 784 DPINSHVSSHQAIHLTKFKKLDSGRRTLMLQQLNRIK 820 > xla:414652 lap3, MGC81140; leucine aminopeptidase 3; K11142 cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5] Length=495 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Query 46 DAKGYQVVADAVLKVDSFNPQA---AARLAGA 74 DA+G ++ADA+ SFNP+A AA L GA Sbjct 338 DAEGRLILADALCYAHSFNPRAIVNAATLTGA 369 > sce:YPR160W GPH1; Gph1p (EC:2.4.1.1); K00688 starch phosphorylase [EC:2.4.1.1] Length=902 Score = 28.9 bits (63), Expect = 4.7, Method: Compositional matrix adjust. Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 0/44 (0%) Query 3 DLPDQVERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKD 46 DLP ++ VLS + F+ +NPN + L + Y+ ++ D Sbjct 802 DLPSSLDSVLSYIESGQFSPENPNEFKPLVDSIKYHGDYYLVSD 845 > cpv:cgd5_1540 hypothetical protein Length=460 Score = 28.5 bits (62), Expect = 5.1, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 0/38 (0%) Query 22 FKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLK 59 + ++S+F F +N+ F +K K Q+VA V K Sbjct 35 YTTSKEVKSMFNVFAFNQKRFGKKKGKVEQIVAKFVCK 72 > cpv:cgd2_3030 hypothetical protein Length=704 Score = 28.1 bits (61), Expect = 6.7, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Query 48 KGYQVVADAVLKVDSFNPQAAARLAGAFLPWQRYDKHRQQQMKEQLIRI 96 + Y++ + + K D P+ GA L +RYDKHR++ E ++ I Sbjct 161 ESYKITTNDIYK-DELKPRKYEYAIGATLRDKRYDKHRKESNNEIVLVI 208 Lambda K H 0.324 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2041372988 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40