bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2480_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_005180 U1 small nuclear ribonucleoprotein, putative... 71.2 6e-13 ath:AT3G50670 U1-70K; U1-70K (U1 SMALL NUCLEAR RIBONUCLEOPROTE... 65.1 5e-11 tpv:TP02_0544 U1 small nuclear ribonucleoprotein; K11093 U1 sm... 62.8 3e-10 bbo:BBOV_II005790 18.m06481; u1 snRNP; K11093 U1 small nuclear... 58.5 4e-09 cel:K04G7.10 rnp-7; RNP (RRM RNA binding domain) containing fa... 48.5 5e-06 pfa:MAL13P1.338 U1 small nuclear ribonucleoprotein, putative; ... 48.1 7e-06 cpv:cgd6_990 U1 snrp Snp1p. RRM domain containing protein 47.8 8e-06 xla:397946 snrnp70, MGC130688, snrp70; small nuclear ribonucle... 40.0 0.002 dre:445398 snrnp70, MGC136450, snrp70, wu:fc20b04, zgc:136450;... 40.0 0.002 mmu:20637 Snrnp70, 2700022N21Rik, 3200002N22Rik, 70kDa, AI3250... 39.7 0.002 hsa:6625 SNRNP70, RNPU1Z, RPU1, SNRP70, Snp1, U1-70K, U170K, U... 39.7 0.002 dre:569999 snrnp35, MGC112337, zgc:112337; small nuclear ribon... 36.6 0.021 dre:393572 traf3ip1, Elipsa, MGC63522, zgc:63522; TNF receptor... 33.9 0.13 ath:AT2G43370 U1 small nuclear ribonucleoprotein 70 kDa, putat... 33.5 0.15 hsa:11083 DIDO1, BYE1, C20orf158, DATF1, DIDO2, DIDO3, DIO-1, ... 30.8 1.2 dre:794108 nipblb, nipbl, wu:fi33d08; nipped-b homolog b (Dros... 30.4 1.3 ath:AT4G36690 ATU2AF65A; RNA binding / nucleic acid binding / ... 30.4 1.5 dre:323246 cic, wu:fb93c01; capicua homolog (Drosophila) 29.6 2.2 xla:779322 snrnp35, MGC154877, u1snrnpbp; small nuclear ribonu... 29.3 3.1 hsa:11066 SNRNP35, HM-1, MGC138160, U1SNRNPBP; small nuclear r... 28.1 6.9 dre:553240 rbmx2, im:7141316, zgc:113884; RNA binding motif pr... 28.1 7.4 > tgo:TGME49_005180 U1 small nuclear ribonucleoprotein, putative ; K11093 U1 small nuclear ribonucleoprotein 70kDa Length=274 Score = 71.2 bits (173), Expect = 6e-13, Method: Compositional matrix adjust. Identities = 33/35 (94%), Positives = 35/35 (100%), Gaps = 0/35 (0%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRGA 35 KIDGRRVLVDVERARTVPGWLPRRLGGGRG+PRG+ Sbjct 162 KIDGRRVLVDVERARTVPGWLPRRLGGGRGKPRGS 196 > ath:AT3G50670 U1-70K; U1-70K (U1 SMALL NUCLEAR RIBONUCLEOPROTEIN-70K); RNA binding / nucleic acid binding / nucleotide binding; K11093 U1 small nuclear ribonucleoprotein 70kDa Length=427 Score = 65.1 bits (157), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 12/94 (12%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRG------AGKNQPDISSLVAQISAPPP 54 KIDGRRVLVDVER RTVP W PRRLGGG G R G+ QP +Q P Sbjct 203 KIDGRRVLVDVERGRTVPNWRPRRLGGGLGTSRVGGGEEIVGEQQP--QGRTSQSEEPSR 260 Query 55 SSDSKDKTRDRDRDRERDR----ERDRDRERDTP 84 + ++K+R++ ++RER R E+ R+R RD P Sbjct 261 PREEREKSREKGKERERSRELSHEQPRERSRDRP 294 > tpv:TP02_0544 U1 small nuclear ribonucleoprotein; K11093 U1 small nuclear ribonucleoprotein 70kDa Length=227 Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 32/46 (69%), Positives = 35/46 (76%), Gaps = 0/46 (0%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRGAGKNQPDISSLV 46 KI GRRV+VDVERARTV GWLPRRLGGG+G+ RGA D LV Sbjct 171 KISGRRVIVDVERARTVEGWLPRRLGGGKGKSRGAPPKFYDGKPLV 216 > bbo:BBOV_II005790 18.m06481; u1 snRNP; K11093 U1 small nuclear ribonucleoprotein 70kDa Length=247 Score = 58.5 bits (140), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 0/53 (0%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRGAGKNQPDISSLVAQISAPP 53 K+ GRRVLVDVERARTV GW P+RLGGG+G+ R D L+ + PP Sbjct 171 KVSGRRVLVDVERARTVAGWYPKRLGGGKGRSRTKPPKFYDEKPLILEEHLPP 223 > cel:K04G7.10 rnp-7; RNP (RRM RNA binding domain) containing family member (rnp-7); K11093 U1 small nuclear ribonucleoprotein 70kDa Length=332 Score = 48.5 bits (114), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 7/82 (8%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRGAGKNQPDISSLVAQISAPPPSSDSKD 60 K+DG+R++VD ER RT WLPRRLGGG+G R + + + I +S Sbjct 168 KVDGKRLVVDYERGRTQKTWLPRRLGGGKGDTRKTREAK-------SVIEEREIASGFGG 220 Query 61 KTRDRDRDRERDRERDRDRERD 82 DRDR+R R+R +D R+ Sbjct 221 GYEDRDRERSGSRDRRQDSYRN 242 > pfa:MAL13P1.338 U1 small nuclear ribonucleoprotein, putative; K11093 U1 small nuclear ribonucleoprotein 70kDa Length=423 Score = 48.1 bits (113), Expect = 7e-06, Method: Composition-based stats. Identities = 23/45 (51%), Positives = 34/45 (75%), Gaps = 0/45 (0%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRGAGKNQPDISSL 45 KI+ RR+LVD+ER RT+ W+PRRLGGG+G RG+ + + I ++ Sbjct 162 KIENRRILVDIERGRTIKNWIPRRLGGGKGPARGSEEKKKIIHNI 206 > cpv:cgd6_990 U1 snrp Snp1p. RRM domain containing protein Length=281 Score = 47.8 bits (112), Expect = 8e-06, Method: Composition-based stats. Identities = 25/36 (69%), Positives = 28/36 (77%), Gaps = 0/36 (0%) Query 2 IDGRRVLVDVERARTVPGWLPRRLGGGRGQPRGAGK 37 IDG +VLVDVER RTV WLP+RLGGG G+ RG K Sbjct 168 IDGWKVLVDVERGRTVENWLPKRLGGGLGKVRGQEK 203 > xla:397946 snrnp70, MGC130688, snrp70; small nuclear ribonucleoprotein 70kDa (U1); K11093 U1 small nuclear ribonucleoprotein 70kDa Length=471 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%) Query 1 KIDGRRVLVDVERARTVPGW 20 KIDGRRVLVDVER RTV GW Sbjct 171 KIDGRRVLVDVERGRTVKGW 190 > dre:445398 snrnp70, MGC136450, snrp70, wu:fc20b04, zgc:136450; small nuclear ribonucleoprotein 70 (U1); K11093 U1 small nuclear ribonucleoprotein 70kDa Length=495 Score = 40.0 bits (92), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%) Query 1 KIDGRRVLVDVERARTVPGW 20 KIDGRRVLVDVER RTV GW Sbjct 168 KIDGRRVLVDVERGRTVKGW 187 > mmu:20637 Snrnp70, 2700022N21Rik, 3200002N22Rik, 70kDa, AI325098, R74807, Rnulp70, Snrp70, Srnp70, U1-70, U1-70K; small nuclear ribonucleoprotein 70 (U1); K11093 U1 small nuclear ribonucleoprotein 70kDa Length=448 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%) Query 1 KIDGRRVLVDVERARTVPGW 20 KIDGRRVLVDVER RTV GW Sbjct 168 KIDGRRVLVDVERGRTVKGW 187 > hsa:6625 SNRNP70, RNPU1Z, RPU1, SNRP70, Snp1, U1-70K, U170K, U1AP, U1RNP; small nuclear ribonucleoprotein 70kDa (U1); K11093 U1 small nuclear ribonucleoprotein 70kDa Length=437 Score = 39.7 bits (91), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/20 (90%), Positives = 18/20 (90%), Gaps = 0/20 (0%) Query 1 KIDGRRVLVDVERARTVPGW 20 KIDGRRVLVDVER RTV GW Sbjct 168 KIDGRRVLVDVERGRTVKGW 187 > dre:569999 snrnp35, MGC112337, zgc:112337; small nuclear ribonucleoprotein 35 (U11/U12); K13155 U11/U12 small nuclear ribonucleoprotein 35 kDa protein Length=208 Score = 36.6 bits (83), Expect = 0.021, Method: Compositional matrix adjust. Identities = 23/45 (51%), Positives = 31/45 (68%), Gaps = 6/45 (13%) Query 2 IDGRRVLVDVERARTVPGWLPRRLGGGR------GQPRGAGKNQP 40 +D +LVDVE+ RT+PGW PRRLGGG+ GQ R G+++P Sbjct 116 LDQYELLVDVEQERTLPGWRPRRLGGGQGGQKESGQLRFGGRDRP 160 > dre:393572 traf3ip1, Elipsa, MGC63522, zgc:63522; TNF receptor-associated factor 3 interacting protein 1 Length=629 Score = 33.9 bits (76), Expect = 0.13, Method: Compositional matrix adjust. Identities = 15/24 (62%), Positives = 23/24 (95%), Gaps = 0/24 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERD 82 KDKTR+++R+RE+DR R+++RERD Sbjct 224 KDKTREKEREREKDRNREKERERD 247 Score = 29.6 bits (65), Expect = 2.6, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 25/29 (86%), Gaps = 0/29 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERDTPSQR 87 KDK+RDR++D+ R++ER+R+++R+ +R Sbjct 216 KDKSRDREKDKTREKEREREKDRNREKER 244 Score = 28.9 bits (63), Expect = 4.2, Method: Compositional matrix adjust. Identities = 13/22 (59%), Positives = 19/22 (86%), Gaps = 0/22 (0%) Query 61 KTRDRDRDRERDRERDRDRERD 82 K RDRD+D+ RDRE+D+ RE++ Sbjct 210 KDRDRDKDKSRDREKDKTREKE 231 Score = 28.9 bits (63), Expect = 4.4, Method: Compositional matrix adjust. Identities = 12/23 (52%), Positives = 22/23 (95%), Gaps = 0/23 (0%) Query 59 KDKTRDRDRDRERDRERDRDRER 81 K++ R++DR+RE++RERD+DR++ Sbjct 230 KEREREKDRNREKERERDKDRDK 252 > ath:AT2G43370 U1 small nuclear ribonucleoprotein 70 kDa, putative; K13155 U11/U12 small nuclear ribonucleoprotein 35 kDa protein Length=333 Score = 33.5 bits (75), Expect = 0.15, Method: Compositional matrix adjust. Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 0/22 (0%) Query 2 IDGRRVLVDVERARTVPGWLPR 23 IDGR ++VD R + +PGW+PR Sbjct 130 IDGREIIVDYNRQQLMPGWIPR 151 > hsa:11083 DIDO1, BYE1, C20orf158, DATF1, DIDO2, DIDO3, DIO-1, DIO1, DKFZp434P1115, FLJ11265, KIAA0333, MGC16140, dJ885L7.8; death inducer-obliterator 1 Length=2240 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/24 (62%), Positives = 18/24 (75%), Gaps = 0/24 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERD 82 KD +RD DR+RER RDR+RE D Sbjct 2141 KDSSRDWDRNRERSANRDREREAD 2164 > dre:794108 nipblb, nipbl, wu:fi33d08; nipped-b homolog b (Drosophila); K06672 cohesin loading factor subunit SCC2 Length=2856 Score = 30.4 bits (67), Expect = 1.3, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 21/24 (87%), Gaps = 0/24 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERD 82 +DK RD+DRD+ R+++RD+ RE+D Sbjct 800 RDKVRDKDRDKVREKDRDKVREKD 823 Score = 28.9 bits (63), Expect = 3.6, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 21/24 (87%), Gaps = 0/24 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERD 82 +DK R++DRD+ R+++RD+ RE+D Sbjct 808 RDKVREKDRDKVREKDRDKLREKD 831 Score = 28.9 bits (63), Expect = 4.2, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 22/26 (84%), Gaps = 2/26 (7%) Query 59 KDKTRDRDRD--RERDRERDRDRERD 82 +DK R++DRD RE+DRE+ R+R+RD Sbjct 816 RDKVREKDRDKLREKDREKIRERDRD 841 Score = 28.1 bits (61), Expect = 6.7, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 21/25 (84%), Gaps = 0/25 (0%) Query 58 SKDKTRDRDRDRERDRERDRDRERD 82 ++DK ++DRD+ RD++RD+ RE+D Sbjct 791 NQDKELEKDRDKVRDKDRDKVREKD 815 Score = 28.1 bits (61), Expect = 7.0, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 21/24 (87%), Gaps = 0/24 (0%) Query 59 KDKTRDRDRDRERDRERDRDRERD 82 +DK R++DR++ R+R+RD+ RE+D Sbjct 824 RDKLREKDREKIRERDRDKGREKD 847 > ath:AT4G36690 ATU2AF65A; RNA binding / nucleic acid binding / nucleotide binding Length=573 Score = 30.4 bits (67), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Query 54 PSSDSKDKTRD--RDRDRERDRERDRDRERDTPSQR 87 P +S+D R+ R +DRER++ RD+DRERD+ R Sbjct 37 PKRESRDHERETSRSKDREREKGRDKDRERDSEVSR 72 Score = 28.1 bits (61), Expect = 7.2, Method: Compositional matrix adjust. Identities = 14/26 (53%), Positives = 19/26 (73%), Gaps = 0/26 (0%) Query 57 DSKDKTRDRDRDRERDRERDRDRERD 82 DS+ R RDRD E+ +ER RD++RD Sbjct 67 DSEVSRRSRDRDGEKSKERSRDKDRD 92 > dre:323246 cic, wu:fb93c01; capicua homolog (Drosophila) Length=2350 Score = 29.6 bits (65), Expect = 2.2, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 3/65 (4%) Query 22 PRRLGGGRGQPRGAGKNQPD-ISSLVAQISAPPPSSDSKDKTRDRDRDRERDRERDRDRE 80 P G G P+ P + + +A I P S D + ++R+++R+RD+ER+R+++ Sbjct 1957 PSHSGSAPGTPKLITARPPQKVKATLANI--PVGSYDGGGRGKEREKERDRDKEREREKD 2014 Query 81 RDTPS 85 +DT S Sbjct 2015 KDTSS 2019 > xla:779322 snrnp35, MGC154877, u1snrnpbp; small nuclear ribonucleoprotein 35kDa (U11/U12); K13155 U11/U12 small nuclear ribonucleoprotein 35 kDa protein Length=272 Score = 29.3 bits (64), Expect = 3.1, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 26/45 (57%), Gaps = 6/45 (13%) Query 2 IDGRRVLVDVERARTVPGWLPRRLGGGR------GQPRGAGKNQP 40 ID R V VD E R + GW+PRR GGG GQ R G+++P Sbjct 117 IDQREVFVDFELERNLKGWIPRRFGGGFGGKKESGQLRFGGRDRP 161 > hsa:11066 SNRNP35, HM-1, MGC138160, U1SNRNPBP; small nuclear ribonucleoprotein 35kDa (U11/U12); K13155 U11/U12 small nuclear ribonucleoprotein 35 kDa protein Length=246 Score = 28.1 bits (61), Expect = 6.9, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Query 2 IDGRRVLVDVERARTVPGWLPRRLGGGR------GQPRGAGKNQP 40 ID + VD E RT+ GW+PRRLGGG GQ R G+++P Sbjct 117 IDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRP 161 > dre:553240 rbmx2, im:7141316, zgc:113884; RNA binding motif protein, X-linked 2; K13107 RNA-binding motif protein, X-linked 2 Length=434 Score = 28.1 bits (61), Expect = 7.4, Method: Compositional matrix adjust. Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 0/30 (0%) Query 58 SKDKTRDRDRDRERDRERDRDRERDTPSQR 87 +D+ R+RD R+RD ERDR+RERD QR Sbjct 354 ERDQERERDGGRQRDGERDRERERDGGRQR 383 Lambda K H 0.313 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2021645584 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40