bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2578_orf1 Length=85 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_021270 2OG-Fe(II) oxygenase family protein, putativ... 91.3 7e-19 tgo:TGME49_090920 2OG-Fe(II) oxygenase family protein (EC:1.14... 87.4 1e-17 tpv:TP03_0420 hypothetical protein 77.8 8e-15 bbo:BBOV_IV002340 21.m02798; prolyl 4-hydroxylase alpha-relate... 74.3 8e-14 pfa:MAL8P1.8 conserved Plasmodium protein, unknown function 63.9 1e-10 ath:AT5G66060 iron ion binding / oxidoreductase/ oxidoreductas... 45.4 5e-05 ath:AT3G28480 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 42.4 3e-04 ath:AT2G43080 AT-P4H-1 (A. THALIANA P4H ISOFORM 1); oxidoreduc... 41.6 7e-04 ath:AT1G20270 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 41.6 7e-04 ath:AT4G35810 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 41.2 8e-04 ath:AT4G35820 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 41.2 8e-04 ath:AT3G06300 AT-P4H-2 (A. THALIANA P4H ISOFORM 2); oxidoreduc... 39.7 0.002 ath:AT2G17720 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 38.1 0.006 ath:AT5G18900 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 38.1 0.007 cpv:cgd3_3910 prolyl 4-hydroxylase alpha subunit 35.8 0.038 ath:AT4G33910 oxidoreductase, 2OG-Fe(II) oxygenase family prot... 32.7 0.27 eco:b2675 nrdE, ECK2669, JW2650; ribonucleoside-diphosphate re... 32.0 0.51 > tgo:TGME49_021270 2OG-Fe(II) oxygenase family protein, putative (EC:1.14.11.2); K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=401 Score = 91.3 bits (225), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 42/75 (56%), Positives = 57/75 (76%), Gaps = 0/75 (0%) Query 11 YKTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHH 70 Y +++S +RTS+SV L A+T V ++E + A A +P++HLE LV+VRY EG+YF H Sbjct 254 YTSSKSPSRTSWSVPLAIAETEIVENIERIVSAFAGMPVEHLEPLVVVRYEEGQYFKLHS 313 Query 71 DGGFRPKTVLLYLND 85 DGGFRPKT+LLYLND Sbjct 314 DGGFRPKTILLYLND 328 > tgo:TGME49_090920 2OG-Fe(II) oxygenase family protein (EC:1.14.11.2) Length=967 Score = 87.4 bits (215), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 0/75 (0%) Query 11 YKTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHH 70 Y + ES +RTS SV L +TP V ++E + A A++P+ HLE LV+V+Y EGE+F +HH Sbjct 525 YSSGESLSRTSMSVRLAPGETPEVENLENIVAAFAEMPISHLEPLVVVKYEEGEFFKQHH 584 Query 71 DGGFRPKTVLLYLND 85 DG FR T+L+YLND Sbjct 585 DGHFRRTTILVYLND 599 > tpv:TP03_0420 hypothetical protein Length=281 Score = 77.8 bits (190), Expect = 8e-15, Method: Composition-based stats. Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 1/84 (1%) Query 2 STTSAPQTAYKTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYA 61 ST S P+ Y T SRTR S S++ E + + VE A +A + +++LE LV+V+Y Sbjct 134 STHSLPEE-YTTLVSRTRKSKSIIFEHYEDEIISKVEERAALVAGIDVKYLEKLVMVKYN 192 Query 62 EGEYFSEHHDGGFRPKTVLLYLND 85 G+YF++HHDG FR T+LLYLND Sbjct 193 PGDYFNQHHDGSFRSHTLLLYLND 216 > bbo:BBOV_IV002340 21.m02798; prolyl 4-hydroxylase alpha-related protein PH4 Length=241 Score = 74.3 bits (181), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 0/81 (0%) Query 5 SAPQTAYKTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGE 64 S+ +Y T S TR S S + + +T + +E +A + + HLE LV+V+Y+ G+ Sbjct 96 SSHPDSYTTQVSATRRSQSAVFQHGETEIIARIEHRVSLIAGVSVDHLERLVMVKYSPGD 155 Query 65 YFSEHHDGGFRPKTVLLYLND 85 YF EHHDG FR TVLLYLND Sbjct 156 YFKEHHDGAFRTHTVLLYLND 176 > pfa:MAL8P1.8 conserved Plasmodium protein, unknown function Length=441 Score = 63.9 bits (154), Expect = 1e-10, Method: Composition-based stats. Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 20/102 (19%) Query 4 TSAPQTAYKTTESRTRTSYSVML---------EEAQT-----------PGVMSVELLACA 43 ++ Q YK T S RTS +V L EE Q ++ +E C Sbjct 144 SNEKQEQYKLTNSINRTSSTVFLYTLRSRSVIEENQIDEDSSIVYTKDENIIELENTICN 203 Query 44 LAQLPLQHLESLVLVRYAEGEYFSEHHDGGFRPKTVLLYLND 85 L ++PL +LE L +V+Y + YF+ HHDG FR T+L+YLND Sbjct 204 LVKIPLCYLEPLAIVKYEKNNYFNLHHDGSFRRATLLIYLND 245 > ath:AT5G66060 iron ion binding / oxidoreductase/ oxidoreductase, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=289 Score = 45.4 bits (106), Expect = 5e-05, Method: Composition-based stats. Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 10/93 (10%) Query 3 TTSAPQTAYKTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAE 62 +T + K+T+SR RTS L + + +E +P++H E L ++ Y Sbjct 113 STVVDEKTGKSTDSRVRTSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYEI 172 Query 63 GEYFSEHHD----------GGFRPKTVLLYLND 85 G+ + H+D GG R TVL+YL+D Sbjct 173 GQKYEPHYDYFMDEYNTRNGGQRIATVLMYLSD 205 > ath:AT3G28480 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=316 Score = 42.4 bits (98), Expect = 3e-04, Method: Composition-based stats. Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 10/84 (11%) Query 12 KTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHD 71 ++ ES RTS + L + Q V +VE A LP ++ ES+ ++ Y G+ + H D Sbjct 100 ESVESEVRTSSGMFLSKRQDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFD 159 Query 72 ----------GGFRPKTVLLYLND 85 GG R TVL+YL++ Sbjct 160 YFHDQANLELGGHRIATVLMYLSN 183 > ath:AT2G43080 AT-P4H-1 (A. THALIANA P4H ISOFORM 1); oxidoreductase, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors / procollagen-proline 4-dioxygenase; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=283 Score = 41.6 bits (96), Expect = 7e-04, Method: Composition-based stats. Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 12/86 (13%) Query 12 KTTESRTRTSYSVMLE--EAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEH 69 K +S RTS + L E P + ++E +Q+P ++ E + ++RY +++ H Sbjct 121 KGVKSDVRTSSGMFLTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPH 180 Query 70 HD----------GGFRPKTVLLYLND 85 HD GG R T+L+YL D Sbjct 181 HDYFADTFNLKRGGQRVATMLMYLTD 206 > ath:AT1G20270 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=287 Score = 41.6 bits (96), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 10/84 (11%) Query 12 KTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHD 71 K+ +SR RTS L + + ++E +P H E L ++ Y G+ + H+D Sbjct 120 KSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYD 179 Query 72 ----------GGFRPKTVLLYLND 85 GG R T+L+YL+D Sbjct 180 YFVDEFNTKNGGQRMATMLMYLSD 203 > ath:AT4G35810 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=290 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 10/84 (11%) Query 12 KTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHD 71 K+ +SR RTS L V +E +P ++ E L ++ Y G+ + HHD Sbjct 124 KSIDSRVRTSSGTFLNRGHDEIVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHD 183 Query 72 ----------GGFRPKTVLLYLND 85 GG R TVL+YL+D Sbjct 184 YFFDEFNVRKGGQRIATVLMYLSD 207 > ath:AT4G35820 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=272 Score = 41.2 bits (95), Expect = 8e-04, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 0/71 (0%) Query 15 ESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHDGGF 74 ES +RTS + V +E +P ++ E+L ++ Y G+ F H DG Sbjct 143 ESSSRTSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQ 202 Query 75 RPKTVLLYLND 85 R TVL+YL+D Sbjct 203 RIATVLMYLSD 213 > ath:AT3G06300 AT-P4H-2 (A. THALIANA P4H ISOFORM 2); oxidoreductase, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors / procollagen-proline 4-dioxygenase; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=299 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 10/80 (12%) Query 16 SRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHD---- 71 S RTS + + + P V +E LP ++ E L ++RY G+ + H D Sbjct 86 SDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHD 145 Query 72 ------GGFRPKTVLLYLND 85 GG R TVLLYL++ Sbjct 146 KVNIARGGHRIATVLLYLSN 165 > ath:AT2G17720 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=291 Score = 38.1 bits (87), Expect = 0.006, Method: Composition-based stats. Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 10/83 (12%) Query 13 TTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHD- 71 + +SR RTS L V +E +P+++ E L ++ Y G+ + H+D Sbjct 125 SKDSRVRTSSGTFLRRGHDEVVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDY 184 Query 72 ---------GGFRPKTVLLYLND 85 GG R TVL+YL+D Sbjct 185 FLDEFNTKNGGQRIATVLMYLSD 207 > ath:AT5G18900 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=298 Score = 38.1 bits (87), Expect = 0.007, Method: Composition-based stats. Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 10/80 (12%) Query 16 SRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHD---- 71 S RTS + + + P V +E LP ++ E + ++RY G+ + H D Sbjct 85 SEVRTSSGTFISKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHD 144 Query 72 ------GGFRPKTVLLYLND 85 GG R T+L+YL++ Sbjct 145 KVNIVRGGHRMATILMYLSN 164 > cpv:cgd3_3910 prolyl 4-hydroxylase alpha subunit Length=717 Score = 35.8 bits (81), Expect = 0.038, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 0/65 (0%) Query 21 SYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFSEHHDGGFRPKTVL 80 S + ++ +TP + +E L ++E +++ +Y+ +Y EHHDG R T+ Sbjct 525 SSTACIQPEETPLIRQIENRLGILVDSSNLYMEPILVHKYSVNDYIKEHHDGDNRTHTIS 584 Query 81 LYLND 85 ++L+D Sbjct 585 VFLSD 589 > ath:AT4G33910 oxidoreductase, 2OG-Fe(II) oxygenase family protein; K00472 prolyl 4-hydroxylase [EC:1.14.11.2] Length=288 Score = 32.7 bits (73), Expect = 0.27, Method: Compositional matrix adjust. Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 12/89 (13%) Query 8 QTAYKTTESRTRTSYSVMLEEAQTPGVMSVELLACALAQLPLQHLESLVLVRYAEGEYFS 67 +TA T +RT + + E T + VE +P H ES ++RY G+ + Sbjct 121 ETAENTKGTRTSSGTFISASEESTGALDFVERKIARATMIPRSHGESFNILRYELGQKYD 180 Query 68 EHHDGGFRP-----------KTVLLYLND 85 H+D F P + LLYL+D Sbjct 181 SHYD-VFNPTEYGPQSSQRIASFLLYLSD 208 > eco:b2675 nrdE, ECK2669, JW2650; ribonucleoside-diphosphate reductase 2, alpha subunit (EC:1.17.4.1); K00525 ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1] Length=714 Score = 32.0 bits (71), Expect = 0.51, Method: Compositional matrix adjust. Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 0/20 (0%) Query 59 RYAEGEYFSEHHDGGFRPKT 78 RYA GEYFS++ G ++PKT Sbjct 527 RYASGEYFSQYLQGNWQPKT 546 Lambda K H 0.315 0.128 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2035463248 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40