bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2735_orf1 Length=87 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_024600 GTP-binding protein, putative ; K06942 84.0 1e-16 bbo:BBOV_IV001640 21.m02943; GTP binding protein; K06942 76.6 2e-14 cpv:cgd6_1670 MJ1332/Ygr210cp-like GTP binding protein; GTpase... 60.5 1e-09 sce:YGR210C Putative protein of unknown function; green fluore... 60.5 1e-09 xla:779417 junb, MGC154397; jun B proto-oncogene 28.1 6.5 xla:432129 junb, MGC81322; jun B proto-oncogene; K09028 transc... 27.7 8.9 > tgo:TGME49_024600 GTP-binding protein, putative ; K06942 Length=451 Score = 84.0 bits (206), Expect = 1e-16, Method: Composition-based stats. Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 2/84 (2%) Query 4 RLEKVRDLMLFRHGSTGIAEALRIAVEVLGQRIAGYPVKSLQLTATDKKGRGPFIECLLV 63 RLEK++D++++R+GS+G+ EA+R AV LG R+ YPV+ T + KG + ECLLV Sbjct 340 RLEKIKDMVIYRYGSSGVHEAIRAAVTRLGNRVPVYPVRHWNTTGS--KGANLYAECLLV 397 Query 64 KKGTTIGDFASLLHPAIGRNFISA 87 + T + DFA +LH A+ RNF+ A Sbjct 398 PRNTRMRDFAGMLHVAMERNFLYA 421 > bbo:BBOV_IV001640 21.m02943; GTP binding protein; K06942 Length=423 Score = 76.6 bits (187), Expect = 2e-14, Method: Composition-based stats. Identities = 40/84 (47%), Positives = 52/84 (61%), Gaps = 1/84 (1%) Query 4 RLEKVRDLMLFRHGSTGIAEALRIAVEVLGQRIAGYPVKSLQLTATDKKGRGPFIECLLV 63 RL +RDL+L+R GSTG+ AL A + G I YPVK+L+ D+ F EC+ V Sbjct 309 RLNNIRDLVLYRFGSTGVTSALNEATKAAGV-ICVYPVKNLKTFGDDESSSKAFRECITV 367 Query 64 KKGTTIGDFASLLHPAIGRNFISA 87 GTT+ +FAS+LH IGRNF A Sbjct 368 MPGTTVREFASMLHFEIGRNFHKA 391 > cpv:cgd6_1670 MJ1332/Ygr210cp-like GTP binding protein; GTpase OBG family plus RNA binding domain TGS ; K06942 Length=443 Score = 60.5 bits (145), Expect = 1e-09, Method: Composition-based stats. Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 4/86 (4%) Query 4 RLEKVRDLMLFRHGSTGIAEALRIAVEVLGQRIAGYPVKSLQLTAT---DKKGRGPFIEC 60 RLE ++D++LFRHG TG+ +A+ AV++LG I YPVK+++ D+ F +C Sbjct 326 RLENIKDMVLFRHGVTGVQDAVNKAVDLLG-LIPIYPVKNIKTFTNNLHDETNNSAFQDC 384 Query 61 LLVKKGTTIGDFASLLHPAIGRNFIS 86 +LV GT + LH + +N ++ Sbjct 385 ILVPNGTMVKTLLKSLHIDLEKNLVN 410 > sce:YGR210C Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; K06942 Length=411 Score = 60.5 bits (145), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Query 2 FHRLEKVRDLMLFRHGSTGIAEALRIAVEVLGQRIAGYPVKSLQLTATDKKGRGPFIECL 61 +R+E +RDL+L+R GSTG+ + L+ A ++LG I Y VK++Q T T G F +C Sbjct 298 LNRIENIRDLVLYRFGSTGVVQVLQAATDILG-LIPVYTVKNIQ-TFTGGNGTNVFRDCF 355 Query 62 LVKKGTTIGDFA 73 LVK+GT +G A Sbjct 356 LVKRGTPVGKVA 367 > xla:779417 junb, MGC154397; jun B proto-oncogene Length=295 Score = 28.1 bits (61), Expect = 6.5, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 0/46 (0%) Query 6 EKVRDLMLFRHGSTGIAEALRIAVEVLGQRIAGYPVKSLQLTATDK 51 EKVRDL +G +G A ALR VE L R+ + L T K Sbjct 245 EKVRDLKNENNGLSGTAGALREQVEQLKVRVREHARHGCHLLLTGK 290 > xla:432129 junb, MGC81322; jun B proto-oncogene; K09028 transcription factor jun-B Length=302 Score = 27.7 bits (60), Expect = 8.9, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 0/46 (0%) Query 6 EKVRDLMLFRHGSTGIAEALRIAVEVLGQRIAGYPVKSLQLTATDK 51 EKVR+L G +G A ALR VE L R+ + QL T K Sbjct 252 EKVRELKNENSGLSGTAGALREQVEQLKVRVREHARHGCQLLLTGK 297 Lambda K H 0.325 0.142 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2026251472 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40