bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_2950_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_026080 poly(A) polymerase, putative (EC:2.7.7.19); ... 76.3 2e-14 cpv:cgd4_930 pap1p; poly A polymerase (eukaryotic type) ; K143... 39.7 0.002 pfa:PFF1240w poly(A) polymerase PAP, putative (EC:2.7.7.19); K... 36.2 0.026 bbo:BBOV_I000930 16.m00761; poly(A) polymerase PAP; K14376 pol... 33.9 0.12 tpv:TP01_0037 poly(A) polymerase (EC:2.7.7.19); K14376 poly(A)... 33.9 0.12 ath:AT3G46300 hypothetical protein 30.0 1.7 dre:266753 acvrl1, alk1, hm:zehn1109, vgb, zehn1109; activin A... 28.9 3.9 > tgo:TGME49_026080 poly(A) polymerase, putative (EC:2.7.7.19); K14376 poly(A) polymerase [EC:2.7.7.19] Length=811 Score = 76.3 bits (186), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 40/69 (57%), Positives = 48/69 (69%), Gaps = 3/69 (4%) Query 2 SSSMLIALTFASPKAGEAVCDLRPAIAEFVELINGWPERPKLVGSIQLRVRHLRRSQLST 61 +SSML+AL FA V DLRPA EFV+LIN WPER +L G IQLRV+HLRRSQL Sbjct 660 ASSMLVALNFAQ---QPCVIDLRPAAGEFVDLINQWPERAQLDGQIQLRVKHLRRSQLPA 716 Query 62 EIIKTLKSA 70 ++K +A Sbjct 717 YVLKQKPAA 725 > cpv:cgd4_930 pap1p; poly A polymerase (eukaryotic type) ; K14376 poly(A) polymerase [EC:2.7.7.19] Length=699 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query 8 ALTFASPKAGEA-VCDLRPAIAEFVELINGWPERPKLVGSIQLRVRHLRRSQL 59 +T S +G A V DLR AI +FV I W E SI L+VRHLR L Sbjct 461 GVTGVSNSSGTAPVVDLRGAILDFVGFIMNWSEVENYKDSIDLKVRHLRAKDL 513 > pfa:PFF1240w poly(A) polymerase PAP, putative (EC:2.7.7.19); K14376 poly(A) polymerase [EC:2.7.7.19] Length=631 Score = 36.2 bits (82), Expect = 0.026, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 0/57 (0%) Query 3 SSMLIALTFASPKAGEAVCDLRPAIAEFVELINGWPERPKLVGSIQLRVRHLRRSQL 59 SS IAL F E +L AI +F+++ WP++ K + ++ + + +RSQ+ Sbjct 523 SSFFIALIFFYKNPYENTFNLSYAIRDFIDIALNWPQKVKYPNAFKINIMYQKRSQV 579 > bbo:BBOV_I000930 16.m00761; poly(A) polymerase PAP; K14376 poly(A) polymerase [EC:2.7.7.19] Length=512 Score = 33.9 bits (76), Expect = 0.12, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 0/51 (0%) Query 22 DLRPAIAEFVELINGWPERPKLVGSIQLRVRHLRRSQLSTEIIKTLKSAVE 72 D+R +I F E+IN W E I + +R+L+ SQL + K +E Sbjct 459 DMRMSIKGFKEIINSWTEMEAYKDQIAVNIRYLKNSQLPHFVNPRRKRTIE 509 > tpv:TP01_0037 poly(A) polymerase (EC:2.7.7.19); K14376 poly(A) polymerase [EC:2.7.7.19] Length=507 Score = 33.9 bits (76), Expect = 0.12, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 0/43 (0%) Query 22 DLRPAIAEFVELINGWPERPKLVGSIQLRVRHLRRSQLSTEII 64 D+R ++ F ++IN W + K I ++HL+ +QL ++ Sbjct 452 DIRSSVQSFKDIINNWSDMEKYRDQISFNIKHLKNNQLPDYVL 494 > ath:AT3G46300 hypothetical protein Length=141 Score = 30.0 bits (66), Expect = 1.7, Method: Compositional matrix adjust. Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Query 26 AIAEFVELIN--GWPERPKLVGSIQLRVRHLRRSQLSTEIIKTLKSAVEAHQQQRNRSRR 83 A AEFV IN G R +V SI R +LR STE + + R ++ Sbjct 34 AEAEFVRSINHDGSQHRTTVVDSISCRQMYLRSYTFSTEENEEDGDGGDGEAVTRRHNQS 93 Query 84 CRRGG 88 C RGG Sbjct 94 CFRGG 98 > dre:266753 acvrl1, alk1, hm:zehn1109, vgb, zehn1109; activin A receptor type II-like 1 (EC:2.7.11.30) Length=499 Score = 28.9 bits (63), Expect = 3.9, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 0/43 (0%) Query 58 QLSTEIIKTLKSAVEAHQQQRNRSRRCRRGGKCCLMYLPRWII 100 L TEI+ T AH+ ++R+ +R G+CC+ L +I Sbjct 304 HLHTEILSTQGKPAIAHRDLKSRNILVKRNGQCCIADLGLAVI 346 Lambda K H 0.324 0.133 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2007980300 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40