bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_3056_orf3 Length=79 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_065830 hypothetical protein ; K01113 alkaline phosp... 68.6 5e-12 cpv:cgd7_1430 possible phosphodiesterase/alkaline phosphatase ... 39.7 0.003 pfa:PFI0605c conserved Plasmodium protein, unknown function; K... 33.5 0.15 bbo:BBOV_I003300 19.m02166; hypothetical protein; K01113 alkal... 32.0 0.55 sce:YER015W FAA2, FAM1; Faa2p (EC:6.2.1.3); K01897 long-chain ... 29.6 2.8 tgo:TGME49_095790 hypothetical protein 28.9 4.2 hsa:5310 PKD1, PBP, Pc-1, TRPP1; polycystic kidney disease 1 (... 28.5 4.9 dre:100333329 MAP7 domain containing 2-like 28.1 8.0 > tgo:TGME49_065830 hypothetical protein ; K01113 alkaline phosphatase D [EC:3.1.3.1] Length=614 Score = 68.6 bits (166), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 0/60 (0%) Query 20 VFETVAAKKPDGWIWIGDAGYAEGPDVASVEASLSAVSATQSYKTLKANISFLDGTWDDN 79 V+ V + P+ WIW+GDAGYA+ DVA+V +L V ++ L+A++ FLDGTWDD+ Sbjct 196 VWHRVKEQSPNAWIWMGDAGYAQSHDVAAVRLALKQVKDVDPFRELRASLHFLDGTWDDH 255 > cpv:cgd7_1430 possible phosphodiesterase/alkaline phosphatase D, of possible plant or bacterial origin ; K01113 alkaline phosphatase D [EC:3.1.3.1] Length=463 Score = 39.7 bits (91), Expect = 0.003, Method: Composition-based stats. Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query 7 GQRQIAAAAR-REKVFETVAAKKPDGWIWIGDAGYAEGPDVASVEASLSAVSATQSYKTL 65 GQ+Q + ++ ++ + + KPD W+GD+ Y + V S Y+ L Sbjct 39 GQKQDKSGNYVSQEYWKAIQSDKPDALFWMGDSVYTKCGSPVCVSKGYLVQSNNSFYRDL 98 Query 66 KANISFLDGTWDDN 79 F+DGTWDD+ Sbjct 99 LKTGLFVDGTWDDH 112 > pfa:PFI0605c conserved Plasmodium protein, unknown function; K01113 alkaline phosphatase D [EC:3.1.3.1] Length=446 Score = 33.5 bits (75), Expect = 0.15, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query 20 VFETVAAKKPDGWIWIGDAGYAEGPDVASVEASLSAVSATQSYKTLKANISFLDGTWDDN 79 + ++ +KP +WIGD Y E ++ ++ + + + Y LK +DG +DD+ Sbjct 49 LLNSIEKRKPQLMLWIGDYFYTECSEIKCLDDAYTYIKKDPFYMKLKKKFK-IDGIYDDH 107 > bbo:BBOV_I003300 19.m02166; hypothetical protein; K01113 alkaline phosphatase D [EC:3.1.3.1] Length=754 Score = 32.0 bits (71), Expect = 0.55, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Query 20 VFETVAAKKPDGWIWIGDAGYAE----GPDVASVEASLSAVSATQSYKTLKANISFLDGT 75 +F+ + PD +++ GD Y E P +++ + + Y+ KANI +DG Sbjct 66 IFQRIIDSNPDLFLYTGDIVYPEYGCCSPKC--LQSKYEQLVSHPVYQHFKANIRRIDGV 123 Query 76 WDDN 79 +DD+ Sbjct 124 YDDH 127 > sce:YER015W FAA2, FAM1; Faa2p (EC:6.2.1.3); K01897 long-chain acyl-CoA synthetase [EC:6.2.1.3] Length=744 Score = 29.6 bits (65), Expect = 2.8, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Query 3 KESKGQRQIAAAARREKVF----ETVAAKKPDGWIWIGDAGYAEGPDVASV 49 K+ KG+ QI E+ F ET A DGW GD + +G SV Sbjct 536 KDLKGELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVAFIDGKGRISV 586 > tgo:TGME49_095790 hypothetical protein Length=1386 Score = 28.9 bits (63), Expect = 4.2, Method: Compositional matrix adjust. Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Query 24 VAAKKPD--GWIWIGDAGYAEGPDVASVEASLSAVSATQSYKT 64 + K+P+ GW AG+ PDVAS+ +LS +S +T Sbjct 96 LPEKRPEQNGWQLAAGAGHQSRPDVASLTHALSGSQTEESPRT 138 > hsa:5310 PKD1, PBP, Pc-1, TRPP1; polycystic kidney disease 1 (autosomal dominant); K04985 polycystin 1 Length=4302 Score = 28.5 bits (62), Expect = 4.9, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query 20 VFETVAAKKPDGWIW-IGDAGYAEGPDV 46 +F V +P ++W +GD G+ EGP+V Sbjct 1486 LFSAVGRGRPASYLWDLGDGGWLEGPEV 1513 > dre:100333329 MAP7 domain containing 2-like Length=772 Score = 28.1 bits (61), Expect = 8.0, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Query 4 ESKGQRQIAAAARREKVFETVAAKKPDGWIWIGDAGYAEG-----PDVASVEASL 53 E Q ++ A RR A ++P W W G G EG P ASL Sbjct 206 ERNEQERLEALMRRSTNRNLQADQRPKRWTWCGPPGACEGDSKIAPPCPPASASL 260 Lambda K H 0.311 0.125 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2063098576 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40