bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_3066_orf1 Length=128 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding pr... 68.9 4e-12 > tgo:TGME49_070770 hypothetical protein ; K12822 RNA-binding protein 25 Length=779 Score = 68.9 bits (167), Expect = 4e-12, Method: Compositional matrix adjust. Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 0/53 (0%) Query 76 LRKLDPEAIAAAAENSIYRIAPDGTDRRTYIEEDYRPSRRELERLQNAGRREA 128 L+ ++PE AA+ S+YR+ PDG DRR YI EDYRP RRELERL + RR++ Sbjct 375 LKAMNPELAEAASSCSVYRVGPDGVDRRRYITEDYRPCRRELERLHHLERRDS 427 Lambda K H 0.300 0.118 0.316 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2049573556 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40