bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_3267_orf3 Length=132 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_004120 hypothetical protein 65.5 5e-11 tgo:TGME49_073460 eukaryotic translation initiation factor 3 s... 62.4 4e-10 pfa:PFF0590c homologue of human HSPC025; K15029 translation in... 40.0 0.002 tpv:TP02_0247 hypothetical protein; K15029 translation initiat... 39.7 0.002 tpv:TP01_1190 hypothetical protein 35.4 0.040 bbo:BBOV_I003960 19.m02294; hypothetical protein 33.9 0.15 hsa:5829 PXN, FLJ16691; paxillin; K05760 paxillin 32.3 0.35 mmu:19303 Pxn, AW108311, AW123232, Pax; paxillin; K05760 paxillin 31.2 0.88 ath:AT4G39920 POR; POR (PORCINO); binding 30.8 1.1 dre:393371 dnajc5gb, MGC63689, wu:fa01g12, zgc:63689; DnaJ (Hs... 30.8 1.2 pfa:PFB0125c conserved Plasmodium protein 30.8 1.3 hsa:119016 AGAP4, CTGLF1, MRIP2; ArfGAP with GTPase domain, an... 29.6 2.2 hsa:728404 AGAP8, CTGLF5; ArfGAP with GTPase domain, ankyrin r... 29.6 2.2 sce:YNL245C CWC25; Cwc25p 29.3 3.2 tgo:TGME49_084790 hypothetical protein 28.9 4.1 xla:100529153 rfx6; regulatory factor X, 6 28.5 hsa:7273 TTN, CMD1G, CMH9, CMPD4, DKFZp451N061, EOMFC, FLJ2602... 28.5 5.0 tgo:TGME49_060830 hypothetical protein 28.5 5.2 ath:AT3G14750 hypothetical protein 28.1 6.7 tgo:TGME49_104720 SWIM zinc finger domain-containing protein (... 28.1 7.2 > tgo:TGME49_004120 hypothetical protein Length=475 Score = 65.5 bits (158), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%) Query 1 LGQLQAQAGLLTKTQAQVAAAGLEWLYEDPKNSAEAKEQEREAFLLGKPI 50 L +LQA AGL++K A VAAAGLEWLY++PK EA+E REA+LLGKP+ Sbjct 54 LRKLQADAGLISKQAAVVAAAGLEWLYDEPKGQKEAQEAAREAYLLGKPL 103 > tgo:TGME49_073460 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative ; K15029 translation initiation factor 3 subunit L Length=639 Score = 62.4 bits (150), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Query 75 AAAEQQQRERVEAE-LADEDLDRMMAERVAFEPEVENFLRELYDKLYIRDADAIRRLYE 132 + Q + VE E L D LDRMM E+V FE +VE FLR LYD++Y R+ DAIRRLYE Sbjct 40 VSPSNQASQNVEGEGLDDAALDRMMGEKVRFENDVEEFLRSLYDEVYDRNVDAIRRLYE 98 > pfa:PFF0590c homologue of human HSPC025; K15029 translation initiation factor 3 subunit L Length=656 Score = 40.0 bits (92), Expect = 0.002, Method: Composition-based stats. Identities = 17/38 (44%), Positives = 29/38 (76%), Gaps = 0/38 (0%) Query 95 DRMMAERVAFEPEVENFLRELYDKLYIRDADAIRRLYE 132 + ++ E V+FE EVE FL L+D +Y R+A+AI++L++ Sbjct 9 ENVIEEIVSFEEEVETFLINLHDFVYHRNAEAIKKLFD 46 > tpv:TP02_0247 hypothetical protein; K15029 translation initiation factor 3 subunit L Length=544 Score = 39.7 bits (91), Expect = 0.002, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 0/44 (0%) Query 89 LADEDLDRMMAERVAFEPEVENFLRELYDKLYIRDADAIRRLYE 132 LA + R + + + EPEV +FL L+D LY ++A+A++ LYE Sbjct 11 LATDGPQRTVTQLLPIEPEVVDFLVRLHDNLYRKNAEALKNLYE 54 > tpv:TP01_1190 hypothetical protein Length=346 Score = 35.4 bits (80), Expect = 0.040, Method: Compositional matrix adjust. Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 4/36 (11%) Query 16 AQVAAAGLEWLYEDPKNSAEAKEQEREAFLLGKPIP 51 +++ A GLEWLY DP ++ E++LLG+ IP Sbjct 10 SKIEAEGLEWLYNDP----TQQQNNLESYLLGESIP 41 > bbo:BBOV_I003960 19.m02294; hypothetical protein Length=511 Score = 33.9 bits (76), Expect = 0.15, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query 17 QVAAAGLEWLYEDPKNSAEAKEQEREAFLLGKPI 50 +V A GLEWLY DP ++ ++ + E +LLGK I Sbjct 22 RVEAEGLEWLYADP-SANKSNANQLEEYLLGKSI 54 > hsa:5829 PXN, FLJ16691; paxillin; K05760 paxillin Length=591 Score = 32.3 bits (72), Expect = 0.35, Method: Composition-based stats. Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 16/103 (15%) Query 4 LQAQAGLLTKTQAQV-AAAGLEWLYEDPKNSAEAKEQEREAFLLGKPIPNVAPAADESIE 62 L +AG LTK + + GLE D + S E+ E E+ +P+ PA Sbjct 190 LGGKAGPLTKEKPKRNGGRGLE----DVRPSVESLLDELES-----SVPSPVPAIT---- 236 Query 63 KRVGESSLKAPAAAAEQQQRERVEAELADEDLDRMMAERVAFE 105 V + + +P QQ+ R+ A A +LD +MA F+ Sbjct 237 --VNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFK 277 > mmu:19303 Pxn, AW108311, AW123232, Pax; paxillin; K05760 paxillin Length=557 Score = 31.2 bits (69), Expect = 0.88, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 11/78 (14%) Query 28 EDPKNSAEAKEQEREAFLLGKPIPNVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEA 87 ED + S E+ E E+ +P+ PA V + + +P QQ+ R+ A Sbjct 211 EDVRPSVESLLDELES-----SVPSPVPAIT------VNQGEMSSPQRVTSSQQQTRISA 259 Query 88 ELADEDLDRMMAERVAFE 105 A +LD +MA F+ Sbjct 260 SSATRELDELMASLSDFK 277 > ath:AT4G39920 POR; POR (PORCINO); binding Length=345 Score = 30.8 bits (68), Expect = 1.1, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 0/50 (0%) Query 60 SIEKRVGESSLKAPAAAAEQQQRERVEAELADEDLDRMMAERVAFEPEVE 109 SIE R+ ES L + + + + + + E +A ++L++++AE F P E Sbjct 66 SIESRIAESRLASSSTDSSKLKSDLAEISVAIDNLEKLLAENSYFLPSYE 115 > dre:393371 dnajc5gb, MGC63689, wu:fa01g12, zgc:63689; DnaJ (Hsp40) homolog, subfamily C, member 5 gamma b; K09525 DnaJ homolog subfamily C member 5 Length=211 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Query 27 YEDPKNSAEAKEQER--EAFLLGKPIPNVAPAADESIEKRVG 66 Y DP+ AE +E+ R E ++G+PIP+ APAAD VG Sbjct 145 YVDPEELAEEEERSRDNETIIIGQPIPSPAPAADSGYPVIVG 186 > pfa:PFB0125c conserved Plasmodium protein Length=1341 Score = 30.8 bits (68), Expect = 1.3, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query 52 NVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEAELADEDLDRMMAERVAFEPEVENF 111 N +E +++VG++ + +++ RE + AE+ +E D M E + FE ENF Sbjct 573 NFFEEVEEKYDEKVGKNIFEEVEEKFDEKMRENIFAEIEEEKYDEKMGENI-FEEVEENF 631 > hsa:119016 AGAP4, CTGLF1, MRIP2; ArfGAP with GTPase domain, ankyrin repeat and PH domain 4 Length=663 Score = 29.6 bits (65), Expect = 2.2, Method: Composition-based stats. Identities = 26/84 (30%), Positives = 33/84 (39%), Gaps = 9/84 (10%) Query 52 NVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEAELADEDL------DRMMAERVAFE 105 +V P+ E E G+ AP AAA Q VE EDL DR M E + F Sbjct 23 SVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVE---VGEDLHMHHVRDREMPEALEFN 79 Query 106 PEVENFLRELYDKLYIRDADAIRR 129 P ++ + D IRR Sbjct 80 PSANPEASTIFQRNSQTDVVEIRR 103 > hsa:728404 AGAP8, CTGLF5; ArfGAP with GTPase domain, ankyrin repeat and PH domain 8 Length=663 Score = 29.6 bits (65), Expect = 2.2, Method: Composition-based stats. Identities = 26/84 (30%), Positives = 33/84 (39%), Gaps = 9/84 (10%) Query 52 NVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEAELADEDL------DRMMAERVAFE 105 +V P+ E E G+ AP AAA Q VE EDL DR M E + F Sbjct 23 SVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVE---VGEDLHMHHVRDREMPEALEFN 79 Query 106 PEVENFLRELYDKLYIRDADAIRR 129 P ++ + D IRR Sbjct 80 PSANPEASTIFQRNSQTDVVEIRR 103 > sce:YNL245C CWC25; Cwc25p Length=179 Score = 29.3 bits (64), Expect = 3.2, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 5/31 (16%) Query 18 VAAAGLEWLYEDPKNSAEAKEQEREAFLLGK 48 + +GLEW+Y+D K S E+E +LLGK Sbjct 71 LKKSGLEWMYQDAKLS-----DEKEDYLLGK 96 > tgo:TGME49_084790 hypothetical protein Length=976 Score = 28.9 bits (63), Expect = 4.1, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query 56 AADESIEKRVGESSLKAPAAAAEQQQRERVEAELADEDLDRMMAERVAFEPEVENFLREL 115 A E + + GE + PA + QRE V+ +LA L + A+ + E+ E Sbjct 590 AKAEELYQTCGELIMMQPATINREGQREIVDEKLA--HLKELEAQLASLHQEISTLANEA 647 Query 116 YDKLY 120 DK++ Sbjct 648 TDKVF 652 > xla:100529153 rfx6; regulatory factor X, 6 Length=926 Score = 28.5 bits (62), Expect = 5.0, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 0/50 (0%) Query 44 FLLGKPIPNVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEAELADED 93 F G+P+P VA D+ VG+ L P +Q RE + +ED Sbjct 16 FQNGEPLPKVASGMDDCYGTMVGKDLLSYPQEDLCEQGREGIMLTPEEED 65 > hsa:7273 TTN, CMD1G, CMH9, CMPD4, DKFZp451N061, EOMFC, FLJ26020, FLJ26409, FLJ32040, FLJ34413, FLJ39564, FLJ43066, HMERF, LGMD2J, TMD; titin (EC:2.7.11.1); K12567 titin [EC:2.7.11.1] Length=26926 Score = 28.5 bits (62), Expect = 5.0, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 4/70 (5%) Query 27 YEDPKNSAEAKEQEREAFLLGKPIPNVAPAADESIEKRVGESSLKAPAAAAEQQQRERVE 86 Y P+ + +E ++ IP A A+ E R A AA + +QR+R+ Sbjct 25645 YSSPQAHVKVEETRKDFRYSTYHIPTKAEASTSYAELR----ERHAQAAYRQPKQRQRIM 25700 Query 87 AELADEDLDR 96 AE DE+L R Sbjct 25701 AEREDEELLR 25710 > tgo:TGME49_060830 hypothetical protein Length=1081 Score = 28.5 bits (62), Expect = 5.2, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 0/52 (0%) Query 49 PIPNVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEAELADEDLDRMMAE 100 P +V P A E I R GE PA +E+ +R+ DE+ M+A+ Sbjct 356 PTLSVLPEAAERINSRDGEEPAGHPAGVSEEGSVQRLLCGHTDEENPEMLAD 407 > ath:AT3G14750 hypothetical protein Length=331 Score = 28.1 bits (61), Expect = 6.7, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Query 86 EAELADEDLDRMMAERVAFEPEVENFLRELYDK-----LYIRDADAIR 128 E E+A +L R+M + E E +RE+YDK + +R+ DA+R Sbjct 101 ELEVAQHELQRIMHYIDSLRAEEEIMMREMYDKSMRSEMELREVDAMR 148 > tgo:TGME49_104720 SWIM zinc finger domain-containing protein (EC:2.1.1.43) Length=6036 Score = 28.1 bits (61), Expect = 7.2, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query 50 IPNVAPAADESIEKRVGESSLKAPAAAAEQQQRERVEAELADE 92 IP PAAD S + R G + APA + E + V ++ +DE Sbjct 4908 IPTCVPAADSS-QARGGNGGVSAPAFSKETAEETAVTSDESDE 4949 Lambda K H 0.311 0.128 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2099897216 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40