bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 164,496 sequences; 82,071,388 total letters Query= Eace_3308_orf2 Length=64 Score E Sequences producing significant alignments: (Bits) Value ath:AT5G52560 ATUSP; ATUSP (ARABIDOPSIS THALIANA UDP-SUGAR PYR... 62.4 3e-10 pfa:PFE0875c conserved Plasmodium protein, unknown function 58.9 4e-09 cpv:cgd7_1830 secreted UDP-N-acetylglucosamine pyrophosphoryla... 54.3 1e-07 tgo:TGME49_018200 UDP-N-acetylglucosamine pyrophosphorylase, p... 52.8 3e-07 pfa:MAL13P1.218 UDP-N-acetylglucosamine pyrophosphorylase, put... 40.8 0.001 cpv:cgd4_810 UDP-N-acetylglucosamine pyrophosphorylase ; K0097... 35.8 0.030 cpv:cgd4_2730 coiled-coil protein 29.3 3.3 tgo:TGME49_053900 delta-aminolevulinic acid dehydratase, putat... 28.9 4.4 > ath:AT5G52560 ATUSP; ATUSP (ARABIDOPSIS THALIANA UDP-SUGAR PYROPHOSPHORYLASE); UTP-monosaccharide-1-phosphate uridylyltransferase/ UTP:arabinose-1-phosphate uridylyltransferase/ UTP:galactose-1-phosphate uridylyltransferase/ UTP:glucose-1-phosphate uridylyltransferase/ UTP:xylose-1-phosphate uridylyltransferase/ glucuronate-1-phosphate uridylyltransferase; K12447 UDP-sugar pyrophosphorylase [EC:2.7.7.64] Length=614 Score = 62.4 bits (150), Expect = 3e-10, Method: Composition-based stats. Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Query 1 FVAGGLGERLGYNGIKLSLPVESCTETSYIEYYCSFIRAFQEYAAAKTKKAVH--IPLAL 58 VAGGLGERLGYNGIK++LP E+ T T ++++Y I A QE + IP + Sbjct 133 LVAGGLGERLGYNGIKVALPRETTTGTCFLQHYIESILALQEASNKIDSDGSERDIPFII 192 Query 59 MTSADT 64 MTS DT Sbjct 193 MTSDDT 198 > pfa:PFE0875c conserved Plasmodium protein, unknown function Length=855 Score = 58.9 bits (141), Expect = 4e-09, Method: Composition-based stats. Identities = 30/64 (46%), Positives = 43/64 (67%), Gaps = 0/64 (0%) Query 1 FVAGGLGERLGYNGIKLSLPVESCTETSYIEYYCSFIRAFQEYAAAKTKKAVHIPLALMT 60 +AGGLGERL + IK+ L +E +YIEYYC++IR F++Y + KK ++IP +M Sbjct 288 LLAGGLGERLKHKDIKIKLFTNLISEETYIEYYCNYIRCFEKYIKKEKKKKMNIPFIIML 347 Query 61 SADT 64 S DT Sbjct 348 SDDT 351 > cpv:cgd7_1830 secreted UDP-N-acetylglucosamine pyrophosphorylase family protein, signal peptide Length=654 Score = 54.3 bits (129), Expect = 1e-07, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 0/64 (0%) Query 1 FVAGGLGERLGYNGIKLSLPVESCTETSYIEYYCSFIRAFQEYAAAKTKKAVHIPLALMT 60 VAGGLGERL + GIK+ + + + ++ + Y ++IR +Q + + IPL +MT Sbjct 148 LVAGGLGERLAFEGIKIGIELSMASNITFFQLYTNYIREYQRRLKEAFGEDIVIPLLIMT 207 Query 61 SADT 64 S DT Sbjct 208 SDDT 211 > tgo:TGME49_018200 UDP-N-acetylglucosamine pyrophosphorylase, putative ; K12447 UDP-sugar pyrophosphorylase [EC:2.7.7.64] Length=655 Score = 52.8 bits (125), Expect = 3e-07, Method: Composition-based stats. Identities = 32/92 (34%), Positives = 44/92 (47%), Gaps = 28/92 (30%) Query 1 FVAGGLGERLGYNGIKLSLPVESCTETSYIEYYCSFIRAFQ-----------EYAAAKTK 49 VAGGLGERLGY GIK+ LP E+ T ++ + YC ++ + Q E A ++ Sbjct 109 LVAGGLGERLGYKGIKIGLPCETSTGKTFAQLYCEYLLSIQSGLAREAASGEEEVEATSE 168 Query 50 KAVH-----------------IPLALMTSADT 64 A +PLA+MTS DT Sbjct 169 GASEEGRGEAVNSVSAGRSPCVPLAIMTSDDT 200 > pfa:MAL13P1.218 UDP-N-acetylglucosamine pyrophosphorylase, putative (EC:2.7.7.23); K00972 UDP-N-acetylglucosamine pyrophosphorylase [EC:2.7.7.23] Length=593 Score = 40.8 bits (94), Expect = 0.001, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 0/50 (0%) Query 1 FVAGGLGERLGYNGIKLSLPVESCTETSYIEYYCSFIRAFQEYAAAKTKK 50 F+AGGLG RLG N K+ L V T ++++++ I QEY + KK Sbjct 111 FLAGGLGSRLGLNKPKVLLEVTPLTNKTFLQFFFEQIIFLQEYCSLYEKK 160 > cpv:cgd4_810 UDP-N-acetylglucosamine pyrophosphorylase ; K00972 UDP-N-acetylglucosamine pyrophosphorylase [EC:2.7.7.23] Length=603 Score = 35.8 bits (81), Expect = 0.030, Method: Composition-based stats. Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 16/78 (20%) Query 2 VAGGLGERLGYNGIKLSLPVESCTETSYIEYYCSFIRAFQEYAAAKT------------- 48 ++GG G RLGYNG K P+ ++ S+ + +C I++ + + Sbjct 193 MSGGDGSRLGYNGPKGMYPIGKISKDSFFKIFCQKIQSLIRLVSKENYDHDTDDLKSKET 252 Query 49 ---KKAVHIPLALMTSAD 63 K+ IPL +MTS + Sbjct 253 KYLKEMKEIPLYIMTSEN 270 > cpv:cgd4_2730 coiled-coil protein Length=987 Score = 29.3 bits (64), Expect = 3.3, Method: Composition-based stats. Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 13/75 (17%) Query 1 FVAGGLGERLGYNGIKLSLPVESCTETSY-----------IEYYCSFIRAFQEYAAAKTK 49 FV GL E +G+N +L P ++ SY +EYY + I + +Y Sbjct 125 FVPNGL-EIVGFNSTELDQPKDNLISNSYLEEKNLGFSGQLEYYVNNIESI-DYGQKSGI 182 Query 50 KAVHIPLALMTSADT 64 + + +P+ M + DT Sbjct 183 QPISVPILRMNTIDT 197 > tgo:TGME49_053900 delta-aminolevulinic acid dehydratase, putative (EC:4.2.1.24); K01698 porphobilinogen synthase [EC:4.2.1.24] Length=658 Score = 28.9 bits (63), Expect = 4.4, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%) Query 13 NGIKLSLPVESCTETSYIEYYCSFIRAF 40 + I+ SL +E CT+TS + Y C + +F Sbjct 493 SAIRESLDMEGCTDTSILAYSCKYASSF 520 Lambda K H 0.320 0.134 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2051595972 Database: egene_temp_file_orthology_annotation_similarity_blast_database_966 Posted date: Sep 16, 2011 8:45 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40