bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0049_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1920 76.6 2e-13 > 5807.cgd4_1920 Length=782 Score = 76.6 bits (187), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 35/79 (44%), Positives = 56/79 (70%), Gaps = 1/79 (1%) Query 18 KMQHSLQLASAYALGRALLDVEE-NDGVEVYRQLEPIFTNYTPNFVGCLDYIFFSPFNLE 76 ++ HS++L SAY++ +A+++ N V LEP+FTNYTPN++GCLDY+F++ L Sbjct 676 QLGHSMRLRSAYSMAKAMVEGHNPNMLVSSTESLEPVFTNYTPNYLGCLDYVFYTDERLR 735 Query 77 LVGILEPIFEQQLIREGSS 95 L G+LE + E+ LIRE ++ Sbjct 736 LGGVLELLDEEALIREAAA 754 Lambda K H 0.321 0.134 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40