bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0063_orf2 Length=167 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000013949 74.3 1e-12 > 9031.ENSGALP00000013949 Length=241 Score = 74.3 bits (181), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 8/131 (6%) Query 5 ISGKDAGRGELFITSQRVAWLSDVGASFALNYVSIVLHALSTDPQACDRPCLYCQIKGEA 64 ++G+ G G L+I R++WL + G F+L+Y +I LHA+S D A LY + Sbjct 28 LAGRSLGAGTLYIAESRLSWLENSGVGFSLDYPTISLHAVSRDLNAYPWEHLYVMVNARF 87 Query 65 LADLSNGNPVSSSSSDSACMPEEAEECADDDAMVELKFVPDDPSCLQRLFTVMSDMAALH 124 + + PV+ + + D + + E +FVP D S L+ +F+ M + ALH Sbjct 88 EEEETKEAPVAEGEEEDS--------DDDVEPIAEFRFVPSDKSALEAMFSAMCECQALH 139 Query 125 PDPDSATLDGD 135 PDP+ D D Sbjct 140 PDPEDEDSDND 150 Lambda K H 0.315 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30498925597 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40