bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0113_orf1 Length=203 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_3090 77.4 2e-13 > 5807.cgd4_3090 Length=538 Score = 77.4 bits (189), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 50/198 (25%), Positives = 89/198 (44%), Gaps = 26/198 (13%) Query 4 KGDNCIREEISKTEINCPLGSVYEGGLCINITRVAAHAECPLNYIYNGKECINIIIRDPS 63 +GD C+ +I + + C G + G+C + +V + ++CP I G +CI I Sbjct 208 RGDICVLVDIIRPNLKCEKGFQLKDGVCNRLLQVDSLSQCPAGSIPRGHKCIVITNVPII 267 Query 64 LSCPSSYHLNNTNNKCIKIIEKEPILLCPYKTELIDNKCIEKETIKAKAQCPEGTTAIAA 123 SCPS + L++T +CI++ E+ I CP +L +C+ ++ + CP G+T Sbjct 268 PSCPSDFELDSTGTRCIRMDERPIIQECPQGFKLESGQCVSISNVEPEVSCPPGSTP--- 324 Query 124 TGAAAAAAAGVAAGTGLINNNKYNNKIICESTVSSPPSLRCPLDYLLEGDN-CIRRINGH 182 + ++NK C + ++ P ++CP Y+ G+ CI Sbjct 325 --------------------HGHHNK--CFNIITEQPMMQCPHGYIESGNGECISEKMKP 362 Query 183 LSISCPFSYKLTGEGCYK 200 S+ CP + G C K Sbjct 363 ASVDCPIGFSRQGSQCVK 380 Lambda K H 0.316 0.135 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 49612009869 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40