bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0118_orf1 Length=229 Score E Sequences producing significant alignments: (Bits) Value 9615.ENSCAFP00000028858 101 1e-20 > 9615.ENSCAFP00000028858 Length=468 Score = 101 bits (252), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 78/238 (32%), Positives = 105/238 (44%), Gaps = 61/238 (25%) Query 3 VAEYSELPPSLAE----DG-ALYAWGNVCMHYFSLAFIQAVTSNLAVYEKRFHAAKKKIP 57 V EYSE+ P A+ DG LY+ GN+C H+F+ F+Q V+S K H A KK+P Sbjct 269 VVEYSEVSPETAQLRGPDGHLLYSLGNICNHFFTRGFLQMVSSEFEPLLKP-HVAVKKVP 327 Query 58 ELVCLDHNSGSNQRAAAETPATQDVGTPMTENPRSWALRTPTEANGWKLELFIFDAFAFA 117 + G P+ P + NG K+E F+FD F FA Sbjct 328 --------------------YVDEEGNPVK----------PIKPNGIKMEKFVFDVFPFA 357 Query 118 DRVLCLEVEREEEFAPVKVSGNIEMQALEGQGLEVASVASDTPEHAQLLLSRLHAKWV-- 175 + EV REEEF+P+K AS A D P + L H +W Sbjct 358 KSFVAFEVSREEEFSPLK---------------NAASDARDNPAMTRRALLMQHYRWALQ 402 Query 176 AAAVSLSSLPGRLPEAPH-------HIFCEVSPLLSYEGEGISSGCLKGKDLSKPLLL 226 A A L + RLPE P CE+SPL+SY GEG+ L+G++ P +L Sbjct 403 AGAHFLDACGARLPELPSLPDGTEPPAICEISPLVSYAGEGLEM-YLQGREFRSPFIL 459 Lambda K H 0.316 0.132 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 63790376685 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40