bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0179_orf1 Length=157 Score E Sequences producing significant alignments: (Bits) Value 5207.CNJ00650 210 1e-53 > 5207.CNJ00650 Length=245 Score = 210 bits (534), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 96/155 (61%), Positives = 122/155 (78%), Gaps = 0/155 (0%) Query 3 IPIIHTTISNTHVIGSLSVGNKHGLLLPIGTSDIEMNHIRNSLPEEIRIRRINDKLSALG 62 +PI+HTTI T +IG L+ GN+HGLL+P T+D E+ H+RNSLP + I+R+ ++LSALG Sbjct 46 VPIVHTTIGGTRIIGRLTAGNRHGLLVPSSTTDQELQHLRNSLPPTVAIQRVEERLSALG 105 Query 63 NCIVTNDYTALIHPDIDAETAEIIQDVLHVEVFRSIIGGQLLVGSYCVLTNQGGLVHSGT 122 N I NDY AL+HPDID ET EII D L VEVFR I G +LVGSYC L+NQGGLVH T Sbjct 106 NVIACNDYVALVHPDIDRETEEIIADTLKVEVFRQTIAGNVLVGSYCALSNQGGLVHPKT 165 Query 123 SKEEMEDLSQLVQVPFTAGTVNRGSDLVGAGLMVN 157 S+ E+++LS L+QVP AGTVNRGS+++GAGL+VN Sbjct 166 SRSELDELSSLLQVPLVAGTVNRGSEVIGAGLVVN 200 Lambda K H 0.318 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 24996413160 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40