bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0234_orf1 Length=174 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0805w 84.0 2e-15 > 5833.PFL0805w Length=1073 Score = 84.0 bits (206), Expect = 2e-15, Method: Composition-based stats. Identities = 54/155 (34%), Positives = 76/155 (49%), Gaps = 7/155 (4%) Query 1 PPGFAMCDPHERILFGFAFQVNFLDDGAIAERAEIKSCPAGRDKC--DGLERPAKEGDDA 58 PPG C IL GF+ +NF + ++ I C ++ C +G E K D Sbjct 823 PPGLLTCPIGTTILMGFSINLNFYKNKYLSSTNGITLCEPMKESCSGNGFE---KNYSDI 879 Query 59 RIFALCGAETITGLEQVVVQSPL-KAVAVCPQGSLILTGFSLSLTGGREGPLRTGFFPCR 117 RIFALC + + QVV Q K A CP +IL GF+L G + +PCR Sbjct 880 RIFALCTNKPFDFITQVVQQGEAPKISASCPGELVILFGFALMKGIGSSSANKIDIYPCR 939 Query 118 AGLPTCTA-LGVRGTQQNMVWVACVEDTTPGLQRL 151 G +C A L +Q+M+++ACV+ TT GL+ L Sbjct 940 TGQNSCEAVLQNHKFKQSMIYLACVDKTTNGLEYL 974 Lambda K H 0.322 0.139 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 34096907735 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40