bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0267_orf1 Length=174 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_190 62.4 6e-09 > 5807.cgd2_190 Length=136 Score = 62.4 bits (150), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 42/135 (31%), Positives = 71/135 (52%), Gaps = 6/135 (4%) Query 43 NRR---GALSLGTEPRVCRSIMLFRSSPTNSWKFGFYVGDRLGAWRQKNAKVFCAETAKV 99 NR+ G LG + ++ F + F F G L K + F + K+ Sbjct 5 NRKIGLGCCGLGMILIILGVLLFFDKALLTIGNFTFVAGLTLVLGLSKVTRFFL-KPDKL 63 Query 100 ESIVALHPGVLLIALGYSLIGLPLQLYGLLRLFASFLPQVLGAVRLSPVGCWILQLPGFK 159 + + G+ +I + ++IG LQ++GL LF SFLP ++ ++LSP+ +IL+LPG K Sbjct 64 KGTLFYFGGLFVIIVKSTIIGFILQMFGLFYLFNSFLPNIVSYIKLSPLS-FILELPGIK 122 Query 160 QCTKWVLDGDKQLPL 174 Q ++W+ D ++LPL Sbjct 123 QLSEWIYD-QRRLPL 136 Lambda K H 0.324 0.141 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 34096907735 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40