bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0295_orf2 Length=171 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0233342 104 1e-21 > 44689.DDB_0233342 Length=345 Score = 104 bits (260), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 57/164 (34%), Positives = 93/164 (56%), Gaps = 2/164 (1%) Query 10 KWQKILWKKQPHPDCYVDETFLNTLMRNANLTRYMYSDLCKSTVVLTQHLSCILIFLLVY 69 KW+K L++KQP+ D Y DETFL L++NAN +Y + + + ++Q ++ +++F +++ Sbjct 63 KWKKNLYEKQPYSDNYTDETFLIGLVQNANFIKYDFWTVVLDSFTVSQQITSVILFAIIF 122 Query 70 RMIVKRSLAASTLVIFDVVSLPLGYALRWSLRPAPR--AARQVLQSAIIVFGVLRILAPV 127 +K +L LV L LGY + P+ + R I++FG + L+PV Sbjct 123 FHSLKHTLTLPFLVAMAGGFLVLGYIAIIIIDPSANFLSIRSSFLHIILLFGTVYGLSPV 182 Query 128 LQTLTQSFSDDTVISLTSICLLIHIPLNDYSYVYRNPETIDEPL 171 L+TLT SFSDDT+ +LT I LL H+ +DY Y + P+ Sbjct 183 LRTLTNSFSDDTIWALTFILLLAHLFFHDYGYTNNESQKFSAPV 226 Lambda K H 0.327 0.138 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32237076404 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40