bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0319_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0231285 134 1e-30 > 44689.DDB_0231285 Length=497 Score = 134 bits (336), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 65/114 (57%), Positives = 85/114 (74%), Gaps = 0/114 (0%) Query 2 FYPEEELSENELVIIVQPREAIYLKFYTKKPGLASGLQLTELDLSVMDRLQVDRLPDAYE 61 + ++++S NELV+ +QP EA+YLK +KKPGL + ++ TELDLS R + LPDAYE Sbjct 357 LFSDDDISRNELVMRIQPGEAVYLKLLSKKPGLENKIEQTELDLSYRHRFENLDLPDAYE 416 Query 62 RLLLDVIKGDRQNFVRTDELREAWRIFTPLLKQIDEPGVKPEPYPYGSHGPESA 115 RL+LD IKGD FVR DEL AW+IFTPLL QI++ +KPEPY +GS GP+SA Sbjct 417 RLILDSIKGDHNLFVRDDELDVAWQIFTPLLDQIEKEKIKPEPYSFGSRGPKSA 470 Lambda K H 0.318 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40