bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0369_orf1 Length=151 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.172 115 6e-25 > 5833.MAL13P1.172 Length=260 Score = 115 bits (287), Expect = 6e-25, Method: Compositional matrix adjust. Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 9/148 (6%) Query 4 DGTIEADESMCAWMFDTLIAHFDESNSSSPPPPPSIVSLHRLGVRTPAFVTWMKRRNSSS 63 D ++ + +C+W FDTL +++ N PP + LH+ G + P FV WMK + Sbjct 45 DELVKRKDEICSWCFDTL--YYELKNEKYDYVPPILQKLHKGGFQIPIFVKWMKLYDKKD 102 Query 64 SSSSSSSKEGFREDNVDLRGCIGSLKPIPIMKLKDYALISALQDSRFSPITLSEIPDLKC 123 S + D +L+GCIG L + I+++ YA+ S+L D+RF PITL ++P L Sbjct 103 MGS-------YDYDAYELKGCIGCLADVDILEISYYAIQSSLHDTRFLPITLKDLPYLIV 155 Query 124 HVSLLHSFERAKDVYDWEIGVHGIIIRF 151 ++ L++FE K VYDW IG HGI I F Sbjct 156 SITYLYNFEDCKHVYDWVIGKHGIKINF 183 Lambda K H 0.319 0.133 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40