bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0546_orf1 Length=161 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC3D6.08c 92.0 5e-18 > 4896.SPBC3D6.08c Length=140 Score = 92.0 bits (227), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 48/109 (44%), Positives = 74/109 (67%), Gaps = 8/109 (7%) Query 57 SLEEELDKKVLVILRDGKNLIGMLRSFDQYGNLMLEGCVQRIVVNTFYNDIYQGALIIRG 116 SL + +D+KV+V+LRDGK LIG+LRSFDQ+ NLML+ ++RI V+ Y DI +G I+RG Sbjct 15 SLVDYVDRKVIVVLRDGKKLIGILRSFDQFANLMLQYTIERIYVDDMYGDIDRGVYIVRG 74 Query 117 ENILLFGAVDESKP-------SRLESRPLWEVLEMYEELEKRENRRRRN 158 EN++L G +D K R+ + L+ + +++EE EK++N R + Sbjct 75 ENVVLLGELDLDKEYDAVKQLRRMPAEELYPLAKLHEE-EKKKNIREKG 122 Lambda K H 0.321 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26764363279 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40