bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0562_orf1 Length=94 Score E Sequences producing significant alignments: (Bits) Value 316058.RPB_2988 67.0 1e-10 > 316058.RPB_2988 Length=134 Score = 67.0 bits (162), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 21/110 (19%) Query 3 RQPRPHDGSATEASATP-----SHASGPL----------GLSG------HRRKNWGEDEV 41 R+PRP TEA+AT S A G + G +G + R DEV Sbjct 15 RRPRPQVMRLTEAAATRVKDLMSRADGEIVGLRVGIKNGGCAGQSYTVEYARDLQATDEV 74 Query 42 VVVEGVEIRVAADAVMLLIGTQVDFVDEDVQTGFIFNNPNQKHSCGCGKS 91 + +GV+I + AV+ L+GT++D+ + +Q F+FNNPNQ +CGCG+S Sbjct 75 IEDKGVKILIDPKAVLFLLGTEMDYKADKMQAQFVFNNPNQISACGCGES 124 Lambda K H 0.315 0.133 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40