bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0670_orf2 Length=149 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000006882 82.8 3e-15 > 8090.ENSORLP00000006882 Length=281 Score = 82.8 bits (203), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 49/153 (32%), Positives = 74/153 (48%), Gaps = 30/153 (19%) Query 2 FCGEDDIALPYMPASISAAGAFWISTMLPAFIIVVVEVLLWAVRATQEKDKSEREQQAVV 61 FC +D I P+ P++I++ + + +LP +++ E LL Sbjct 40 FCSDDSIRYPFHPSTITSTVLYTVGFVLPISCMIIGECLL-------------------- 79 Query 62 VVLDRRIPETCV-----HLYTYCGSLAMSVASVFLLTNSLKAAVGSLRPHFLDVCRPDWS 116 V L+R ++C +Y G+ A LT+ K ++G LRPHFLDVC+PDW+ Sbjct 80 VYLNRLHSKSCFGSYVARVYKAVGTFLFGAAMSQSLTDIAKYSIGRLRPHFLDVCKPDWT 139 Query 117 RVSCRDSSGLYDVYIPDFFCTGDPHRVEEARRS 149 R++C VYI +F CTGD V E R S Sbjct 140 RINCS-----LGVYIENFTCTGDAKMVNEGRLS 167 Lambda K H 0.325 0.137 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40