bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0694_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 338969.Rfer_2623 188 5e-47 > 338969.Rfer_2623 Length=292 Score = 188 bits (477), Expect = 5e-47, Method: Compositional matrix adjust. Identities = 86/140 (61%), Positives = 112/140 (80%), Gaps = 0/140 (0%) Query 2 ELTAGLAVVRERAARLPRRPRVYFEEWDEPQISGIRWVSELIGIAGGEDCFAELSVESLG 61 E+ L+V+ + AA LPRRP++YFEEWD P IS I+WVSELIGIAGG+DCF EL+ +S+G Sbjct 142 EMQRQLSVIADAAAALPRRPKIYFEEWDVPHISAIQWVSELIGIAGGDDCFPELAAQSMG 201 Query 62 RNRIIADPLEVPRRAPDIILGSWCGKKFQPSQVAARAGWERIPAIRDGFVREVKSAIILQ 121 +NRIIAD E+ RR PDII+GSWCGKKF+P VAARAGW + A++ G + E+KSA ILQ Sbjct 202 KNRIIADGAEIVRRNPDIIIGSWCGKKFRPENVAARAGWGEVNAVKTGQLFEIKSADILQ 261 Query 122 PGPAALTEGVQAIQQVIEEW 141 PGPAALT+GV + +++ +W Sbjct 262 PGPAALTDGVAQLHRIVMDW 281 Lambda K H 0.320 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40