bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0700_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_1150 137 8e-32 > 5807.cgd8_1150 Length=341 Score = 137 bits (346), Expect = 8e-32, Method: Compositional matrix adjust. Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 6/88 (6%) Query 62 LAEGE------DPNRPVRIYTDGVYDLLHLGHMRQLEQAKKMFKHVYLMAGVASDEETHR 115 LA+G+ D NR +RIY DGVYDLLHLGHMRQLEQAKKM+ + +L+ GVASDEETHR Sbjct 52 LADGQENNKECDTNRKIRIYADGVYDLLHLGHMRQLEQAKKMYPNTHLIVGVASDEETHR 111 Query 116 LKGQTVQSLEERAETLRHIKWVDEVIAP 143 LKG+TVQ+L+ER ETLRH+KWVDE+I+P Sbjct 112 LKGRTVQTLQERTETLRHVKWVDEIISP 139 Lambda K H 0.314 0.129 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40