bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0721_orf1 Length=186 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000005737 212 4e-54 > 7719.ENSCINP00000005737 Length=625 Score = 212 bits (540), Expect = 4e-54, Method: Compositional matrix adjust. Identities = 99/182 (54%), Positives = 130/182 (71%), Gaps = 0/182 (0%) Query 2 IVDCAIKHNICLIPFGGGTSVTLGVCTPEEEERMVATVSLSFMQKILYLDRDALLMWVEA 61 +V A++HN+CLIP GGGT+VTL + PE E R +ATV ++ M +IL++D LL +EA Sbjct 187 LVSAAVRHNVCLIPIGGGTTVTLALACPENESRCIATVDMTQMNQILWVDEKNLLARIEA 246 Query 62 GAVGASIEERLRPYGVTLGHEPDSMEFSTVGGWVATRASGMKKNRYGNIEDLVVDIKVVT 121 G +G +E L G+ GHEPDSMEFS++GGWVATRASGMKKN YGNIEDL+V +K+VT Sbjct 247 GIIGQDLERDLAAMGLCTGHEPDSMEFSSLGGWVATRASGMKKNVYGNIEDLLVHVKMVT 306 Query 122 TRGCMHACNSSPRISSGPSLQQLFLGSEGIYGIITQVLLKIKPIPEYKVYDCLAFPSFSL 181 RG + PR+S+GP L Q LGSEG GIIT+V L+++P+PE + Y + FP F Sbjct 307 PRGVLEKNCMVPRMSAGPDLHQFILGSEGTLGIITEVTLRVRPLPECQRYGSIVFPDFKH 366 Query 182 GV 183 GV Sbjct 367 GV 368 Lambda K H 0.322 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40752393066 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40