bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0731_orf2 Length=173 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL003151-PA 80.9 2e-14 > 7159.AAEL003151-PA Length=296 Score = 80.9 bits (198), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 8/129 (6%) Query 28 TQIREGDERLGKNESRDLRSSACAYSQEKLQPPLLACRIGRLYNKEAVIKALLEKALPPH 87 ++++ E+ K+ R R C +QE+L+ P++ C +GRLY+K+ VI+ LLE +P Sbjct 15 VRLKKKPEQKDKDAERQFRWKHCNLTQERLRQPIVMCGLGRLYSKQNVIEHLLEGKMPDS 74 Query 88 MRHVKSLKDMKELRVEINAS--------TGFPVCPITNADLSSGVRACIVWPCGFIISNR 139 H+KSLKD+K+L + N + +C + ++S R +W CG + S R Sbjct 75 CAHIKSLKDIKDLNLTANPAYEEAQDDKNAQYICALIGLEMSGQFRFVALWKCGCVFSER 134 Query 140 ALEAMTLKD 148 AL+ + K+ Sbjct 135 ALKEVKDKN 143 Lambda K H 0.315 0.131 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 33476963958 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40