bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0733_orf2 Length=139 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0825w 94.4 1e-18 > 5833.PFE0825w Length=440 Score = 94.4 bits (233), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 49/137 (35%), Positives = 85/137 (62%), Gaps = 5/137 (3%) Query 7 LANSIGPRGTLIVASAVQLVGCFVAFGLEEFNELFNAPH----SLPDLSVLSVKVEFHRF 62 + N +G RG L++A QL+ ++ LEE +L + + + ++ +LS+K E+ R Sbjct 174 MVNFVGSRGNLLIALLSQLIALCISTTLEEDPKLLKSSNVDKMKMSEI-LLSIKNEYIRV 232 Query 63 GSIAYRCASNCVVMFVGLFPILMARYAFTPIVVNIYRLTPSQSNLLVTLIGAVMIAAEGL 122 ++ + C+++ GL PILM ++AF P+VV++++LTPS ++ L+T G + I AEG+ Sbjct 233 LNLFKKTYGICLLILFGLLPILMTKFAFAPVVVDMFKLTPSHTSYLMTYAGIITIIAEGI 292 Query 123 LAPLLATRYGDQACIKY 139 LAP L++ GD C KY Sbjct 293 LAPYLSSLLGDMICCKY 309 Lambda K H 0.328 0.141 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40