bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0814_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000002327 126 3e-28 > 42254.ENSSARP00000002327 Length=1257 Score = 126 bits (317), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 68/108 (62%), Positives = 81/108 (75%), Gaps = 8/108 (7%) Query 2 QLSGGQKQRIAIARALIRWPSILIFDEATSALDTQSERVVQEALDSLVKTTKATTLIVAH 61 QLSGGQKQRIAIARALIR P IL+ DEATSALDT+SE++VQEALD T +++AH Sbjct 1152 QLSGGQKQRIAIARALIRQPQILLLDEATSALDTESEKIVQEALDK--AREGRTCIVIAH 1209 Query 62 RLSTIQNADLIVVLEPSATHGATVVQQGTHEQLMRDTKGLYYHMVASQ 109 RLSTIQNADLIVV + + +QGTH+QL+ KGLYY MV+ Q Sbjct 1210 RLSTIQNADLIVVFQ-----NGRIKEQGTHQQLLAQ-KGLYYSMVSVQ 1251 Lambda K H 0.315 0.128 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40