bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0823_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_2390 137 1e-31 > 5807.cgd3_2390 Length=381 Score = 137 bits (346), Expect = 1e-31, Method: Compositional matrix adjust. Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 1/158 (0%) Query 23 IEGPAALVLKATWLAAEAAIRKIEIGAHACEVTKIIEAVAADLGVKPMHGVMCYQMKQHV 82 I G A VLKA A E AIR ++ G VT ++ + + GV+ +Q+K+HV Sbjct 141 ISGKQADVLKAANTAMEVAIRTVKPGNTNTYVTSMLNKTVKEFNCNMVQGVLSHQLKRHV 200 Query 83 IEGSRCFPLVTSTGEDKQEDFTFEANELYSIDIVLSTGDGRPRELEQRPTIYRRAVERKY 142 I+G+R + T ++K ++FTFE NE+Y +DI++S+G+G PRE + R T+++RA+E Y Sbjct 201 IDGNRVI-ISKETLDEKVDEFTFEENEVYGLDILVSSGEGVPRESDYRSTVFKRAIETNY 259 Query 143 ILKSQMARAFMSEVENNFPTLPFSLRQLRDERTSKVGI 180 LKS + R F+SEV FPTLPFSL + DE+ +++G+ Sbjct 260 NLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGV 297 Lambda K H 0.320 0.133 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40