bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0833_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000069571 76.3 2e-13 > 7955.ENSDARP00000069571 Length=211 Score = 76.3 bits (186), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 39/97 (40%), Positives = 58/97 (59%), Gaps = 1/97 (1%) Query 14 VAAGAVDALLPIIHFAVCDFSPNVHSFLRRRGFEFLFKSDKRFVEEVWKFLRQECGYRPA 73 +A G A LPI+ FA FSP++ +L G E +D RF+E V+K LR Y+P Sbjct 31 LAVGDPSACLPIVSFAFTSFSPSLTEYLVDFGVELTGMNDLRFIENVYKVLRDVFSYKPL 90 Query 74 LTASQFLTPVGFAERKLLLCCDLLTIVRAIHNQVQRS 110 LT QFL GFAERK+ + CD++ +V + H ++ ++ Sbjct 91 LTKQQFLQ-FGFAERKVSILCDVIGLVLSKHKELTKN 126 Lambda K H 0.328 0.138 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40